PRGDB00150856 (Cucsa.005470.1)

From PRG Wiki
Jump to: navigation, search
Cucsa.005470.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

protein kinase 2B (best arabidopsis hit)

DNA Sequence

ATGGAAGCATTAAAGGACATAAATAACAACAGAGACCTATTAAATATATATATGAATAACAACGTACTAAGTCTTCCCACACCAAAAACAGAAGGTGAAATACTGTCATCTTCGAATTTGAAGCCTTTCTCTTTCAATGAGCTCAAGAGTGCTACTAGAAATTTTCGACCTGATAGCTTGCTAGGTGAAGGGGGATTTGGTTATGTTTTCAAAGGATGGATTGATGAAAATACATGGGCCGCAGCGAGGCCGGGAATGGGAATGGTTGTTGCAGTCAAGAAGCTTAAGCCTGAAGCTTCCCAAGGCCACAAGGAGTGGTTGACAGAAGTTAATTATTTGGGCAAATTTCATCATCCAAATCTAGTTAAGCTGATTGGGTATTGCTTGGAAGGCGAGAATCGTTTATTGGTATACGAGTTTTTGCCAAGAGGGAGCTTGGAGAATCATCTCTTCAGAAGGGGTTCCCAGCCTCTTTCTTGGGCACTGAGGATCAAAGTGGCAATAGCTGCTGCCAGAGGGCTTTCCTTTCTCCATGAAGCCGAATCACCTGTTATATATCGCGATTTTAAGGCATCCAACATCCTACTTGATGCAGAATTTAATGCAAAGCTTTCTGATTTTGGTTTGGTAAAGGCTGGTCCAACTGGAGATAGAACTCATGTAACTACTCAAGTTATCGGGACCCGTGGCTATGCTGCACCTGAATATATTGCTACAGGTCGACTGACATCCAAAAGTGATGTTTATAGCTTTGGAGTTGTGTTGCTCGAATTGTTGTCAGGTCAACGTGCTGAGGACAATCTTGTTGAGCGGGCAAGCCCTTATTTGGGTGATAAAAGAAAGTTATTCCGAATTATGGACACCAAACTCGAAGGACGATATTCTAAAAAGGGAGCTTATGTAGCTGCAAATTTAGCTTCACAATGTCTTACGAGTGAACCGAGGGCCCGACCTCGAATGGCAGAAATTTTGGGTGCATTGGAGGAACTTGAAACCCCCAAAACTCCAGCTAGAATCTCGCATTCAGTTCAACGTAGTACTCCTACTTTGTCAAACTCGAACCCTGATGGGTCTCTCTCGAAACCGCATCAGAAGTCACCACAACAATAA


Protein sequences

Name Description Sequence
Cucsa.005470.1 protein kinase 2B (best arabidopsis hit)

MEALKDINNNRDLLNIYMNNNVLSLPTPKTEGEILSSSNLKPFSFNELKSATRNFRPDSLLGEGGFGYVFKGWIDENTWAAARPGMGMVVAVKKLKPEASQGHKEWLTEVNYLGKFHHPNLVKLIGYCLEGENRLLVYEFLPRGSLENHLFRRGSQPLSWALRIKVAIAAARGLSFLHEAESPVIYRDFKASNILLDAEFNAKLSDFGLVKAGPTGDRTHVTTQVIGTRGYAAPEYIATGRLTSKSDVYSFGVVLLELLSGQRAEDNLVERASPYLGDKRKLFRIMDTKLEGRYSKKGAYVAANLASQCLTSEPRARPRMAEILGALEELETPKTPARISHSVQRSTPTLSNSNPDGSLSKPHQKSPQQ*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
25-346 FAMILY NOT NAMED,FAMILY NOT NAMED

LPTPKTEGEILSSSNLKPFSFNELKSATRNFRPDSLLGEGGFGYVFKGWIDENTWAAARPGMGMVVAVKKLKPEASQGHKEWLTEVNYLGKFHHPNLVKLIGYCLEGENRLLVYEFLPRGSLENHLFRRGSQPLSWALRIKVAIAAARGLSFLHEAESPVIYRDFKASNILLDAEFNAKLSDFGLVKAGPTGDRTHVTTQVIGTRGYAAPEYIATGRLTSKSDVYSFGVVLLELLSGQRAEDNLVERASPYLGDKRKLFRIMDTKLEGRYSKKGAYVAANLASQCLTSEPRARPRMAEILGALEELETPKTPARISHSVQRS

HMMPanther: PTHR24420:SF897
25-346 SUBFAMILY NOT NAMED

LPTPKTEGEILSSSNLKPFSFNELKSATRNFRPDSLLGEGGFGYVFKGWIDENTWAAARPGMGMVVAVKKLKPEASQGHKEWLTEVNYLGKFHHPNLVKLIGYCLEGENRLLVYEFLPRGSLENHLFRRGSQPLSWALRIKVAIAAARGLSFLHEAESPVIYRDFKASNILLDAEFNAKLSDFGLVKAGPTGDRTHVTTQVIGTRGYAAPEYIATGRLTSKSDVYSFGVVLLELLSGQRAEDNLVERASPYLGDKRKLFRIMDTKLEGRYSKKGAYVAANLASQCLTSEPRARPRMAEILGALEELETPKTPARISHSVQRS

superfamily: SSF56112
IPR011009
27-350 Protein kinase-like (PK-like)
Protein kinase-like domain

TPKTEGEILSSSNLKPFSFNELKSATRNFRPDSLLGEGGFGYVFKGWIDENTWAAARPGMGMVVAVKKLKPEASQGHKEWLTEVNYLGKFHHPNLVKLIGYCLEGENRLLVYEFLPRGSLENHLFRRGSQPLSWALRIKVAIAAARGLSFLHEAESPVIYRDFKASNILLDAEFNAKLSDFGLVKAGPTGDRTHVTTQVIGTRGYAAPEYIATGRLTSKSDVYSFGVVLLELLSGQRAEDNLVERASPYLGDKRKLFRIMDTKLEGRYSKKGAYVAANLASQCLTSEPRARPRMAEILGALEELETPKTPARISHSVQRSTPTL

Gene3D: G3DSA:3.30.200.20
36-126 no description

SSSNLKPFSFNELKSATRNFRPDSLLGEGGFGYVFKGWIDENTWAAARPGMGMVVAVKKLKPEASQGHKEWLTEVNYLGKFHHPNLVKLIG

ProfileScan: PS50011
IPR000719
55-330 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRPDSLLGEGGFGYVFKGWIDENTWAAARPGMGMVVAVKKLKPEASQGHKEWLTEVNYLGKFHHPNLVKLIGYCLEGENRLLVYEFLPRGSLENHLFRRGSQPLSWALRIKVAIAAARGLSFLHEAESPVIYRDFKASNILLDAEFNAKLSDFGLVKAGPTGDRTHVTTQVIGTRGYAAPEYIATGRLTSKSDVYSFGVVLLELLSGQRAEDNLVERASPYLGDKRKLFRIMDTKLEGRYSKKGAYVAANLASQCLTSEPRARPRMAEILGALEEL

HMMSmart: SM00220
IPR002290
55-327 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRPDSLLGEGGFGYVFKGWIDENTWAAARPGMGMVVAVKKLKPEASQGHKEWLTEVNYLGKFHHPNLVKLIGYCLEGENRLLVYEFLPRGSLENHLFRRGSQPLSWALRIKVAIAAARGLSFLHEAESPVIYRDFKASNILLDAEFNAKLSDFGLVKAGPTGDRTHVTTQVIGTRGYAAPEYIATGRLTSKSDVYSFGVVLLELLSGQRAEDNLVERASPYLGDKRKLFRIMDTKLEGRYSKKGAYVAANLASQCLTSEPRARPRMAEILGAL

HMMSmart: SM00219
IPR020635
55-327 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRPDSLLGEGGFGYVFKGWIDENTWAAARPGMGMVVAVKKLKPEASQGHKEWLTEVNYLGKFHHPNLVKLIGYCLEGENRLLVYEFLPRGSLENHLFRRGSQPLSWALRIKVAIAAARGLSFLHEAESPVIYRDFKASNILLDAEFNAKLSDFGLVKAGPTGDRTHVTTQVIGTRGYAAPEYIATGRLTSKSDVYSFGVVLLELLSGQRAEDNLVERASPYLGDKRKLFRIMDTKLEGRYSKKGAYVAANLASQCLTSEPRARPRMAEILGAL

HMMPfam: PF07714
IPR001245
59-325 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SLLGEGGFGYVFKGWIDENTWAAARPGMGMVVAVKKLKPEASQGHKEWLTEVNYLGKFHHPNLVKLIGYCLEGENRLLVYEFLPRGSLENHLFRRGSQPLSWALRIKVAIAAARGLSFLHEAESPVIYRDFKASNILLDAEFNAKLSDFGLVKAGPTGDRTHVTTQVIGTRGYAAPEYIATGRLTSKSDVYSFGVVLLELLSGQRAEDNLVERASPYLGDKRKLFRIMDTKLEGRYSKKGAYVAANLASQCLTSEPRARPRMAEILG

PatternScan: PS00107
IPR017441
61-94 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGYVFKGWIDENTWAAARPGMGMVVAVKK

Gene3D: G3DSA:1.10.510.10
127-326 no description

YCLEGENRLLVYEFLPRGSLENHLFRRGSQPLSWALRIKVAIAAARGLSFLHEAESPVIYRDFKASNILLDAEFNAKLSDFGLVKAGPTGDRTHVTTQVIGTRGYAAPEYIATGRLTSKSDVYSFGVVLLELLSGQRAEDNLVERASPYLGDKRKLFRIMDTKLEGRYSKKGAYVAANLASQCLTSEPRARPRMAEILGA

PatternScan: PS00108
IPR008271
184-196 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox