PRGDB00150857 (Cre03.g168150.t1.1)

From PRG Wiki
Jump to: navigation, search
Cre03.g168150.t1.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Chlamydomonas reinhardtii

Comment?

VH1-interacting kinase (best arabidopsis hit)

DNA Sequence

ATGGGGCCACCGCCAGGCGTGGTGGTTCCCAGGGACATGTACAGCATCCATGGAGAGCAGGCCGCACGACGCCGCGCTATCGCGGAGCTCATATTCTTCGCTGGCGTCAACGACCTACGGAGATGTAGGCAGATCGCCGTCACCTGGAATGTGAAGGTCAACGAGCCGGCGGTGATGGACTACGACCGGCGAACACCCTTGCACGTGTCGGCGGCGGAGGGCGCGTACAGTGTTGTGGAGTGGCTGGTGCAGGAGGGCGCGGACGTGAACGCCATCGACCGGCACGGCCGCACGCCGCTGGAGGAGGCGGCGCGCAATGACCACGGCGAGGTGGTGCGGCTGCTCATACAGCATGGCGCAAACGTGTTTGAGGAGAACAAGCTGGTGGCGCTGGACAAGTCCAAGCTGCGCGGCATTGTGAACACGCGGCGCATCATGATGAACGAGCTGGGCTGGGAGCCGGAGTGGGAGGTCAACCCCAAGGAGCTGCAGCTGGTGGAGCGGATAGGCAGCGGCGAGTTCGGCGACGTGTACAAGGCCAAGTGGCACGGCAGCTATGTGGCCGCCAAGCTGTTGAAGCGCTCGGACGAAATCGCCATTGGCGACTTCCGAACCGAGATCGCCATCCTTCGCAAGATCCACCACCCCAATTGCACGCAGTTCCTGGGCGCCTGCACCAAACAGAAGCCCTACATCGTGATCACGGAGCTCATGGCCTGCTCGCTGGCGGACGCCTTCCAGCGCACCTTCTACACGCCTTCCACACGCCGCCAGGTGGAGATTGCACTGGACTTCGCTCGCGGCATGGCCTACCTGCACAGCCGCCGGCAGCCCATCGTGCACCGCGACCTGAAGCCCGCCAACCTGATGATTGCGGGCAACCTGCACGCCGACACGGAGCAGCTGTATCTGGACAGCGGGGTCATCAAGGTGGCGGACTTCGGTCTGTCCAAGTCGCTGGTGCCTGTGGAGCGCCACGGCGGGCTGAGCCACGACATCAACATCACCTACAAGCTGACCGGCGAGACCGGCAGCTACCGCTACATGGCGCCCGAGTGCTTCAGGCACGAGCCCTACAACCTCAAGGTGGACGTGTACAGCTTTGCCATGATCATCTTCCAGCTGTTTGAGACCACGCAGCCCTTTGCCGGCCACGACCCCGTGGAGGCCGCCCGCAACGCAGCCATGCTGGGGGCGCGGCCCGGCTTCCCGCCGCGCGGCAAGCTCACGGACACGGAGATGTCCATGCGTCGGCTGATTGAGGACTGCTGGGCGGCGGATGCGGAGAAGCGGCCCACCTTTGAGGAGATCATCCAGCGTCTGGAGGCGCAGCTGGCGCGGCTGCCCAAGCATCAGCACTTCGAAAAGGACGCAGCGTGCACCGGCTGCAACGTGCAGTGA


Protein sequences

Name Description Sequence
Cre03.g168150.t1.1 VH1-interacting kinase (best arabidopsis hit)

MGPPPGVVVPRDMYSIHGEQAARRRAIAELIFFAGVNDLRRCRQIAVTWNVKVNEPAVMDYDRRTPLHVSAAEGAYSVVEWLVQEGADVNAIDRHGRTPLEEAARNDHGEVVRLLIQHGANVFEENKLVALDKSKLRGIVNTRRIMMNELGWEPEWEVNPKELQLVERIGSGEFGDVYKAKWHGSYVAAKLLKRSDEIAIGDFRTEIAILRKIHHPNCTQFLGACTKQKPYIVITELMACSLADAFQRTFYTPSTRRQVEIALDFARGMAYLHSRRQPIVHRDLKPANLMIAGNLHADTEQLYLDSGVIKVADFGLSKSLVPVERHGGLSHDINITYKLTGETGSYRYMAPECFRHEPYNLKVDVYSFAMIIFQLFETTQPFAGHDPVEAARNAAMLGARPGFPPRGKLTDTEMSMRRLIEDCWAADAEKRPTFEEIIQRLEAQLARLPKHQHFEKDAACTGCNVQ*

Domains

Domain Start-End Description Sequence

superfamily: SSF48403
IPR020683
31-148 Ankyrin repeat
Ankyrin repeat-containing domain

IFFAGVNDLRRCRQIAVTWNVKVNEPAVMDYDRRTPLHVSAAEGAYSVVEWLVQEGADVNAIDRHGRTPLEEAARNDHGEVVRLLIQHGANVFEENKLVALDKSKLRGIVNTRRIMMN

Gene3D: G3DSA:1.25.40.20
IPR020683
57-127 no description
Ankyrin repeat-containing domain

AVMDYDRRTPLHVSAAEGAYSVVEWLVQEGADVNAIDRHGRTPLEEAARNDHGEVVRLLIQHGANVFEENK

HMMPfam: PF12796
IPR020683
59-125 Ank_2,Ankyrin repeats (3 copies)
Ankyrin repeat-containing domain

MDYDRRTPLHVSAAEGAYSVVEWLVQEGADVNAIDRHGRTPLEEAARNDHGEVVRLLIQHGANVFEE

HMMPanther: PTHR23257:SF89
59-459 ANKYRIN-KINASE,ANKYRIN-KINASE

MDYDRRTPLHVSAAEGAYSVVEWLVQEGADVNAIDRHGRTPLEEAARNDHGEVVRLLIQHGANVFEENKLVALDKSKLRGIVNTRRIMMNELGWEPEWEVNPKELQLVERIGSGEFGDVYKAKWHGSYVAAKLLKRSDEIAIGDFRTEIAILRKIHHPNCTQFLGACTKQKPYIVITELMACSLADAFQRTFYTPSTRRQVEIALDFARGMAYLHSRRQPIVHRDLKPANLMIAGNLHADTEQLYLDSGVIKVADFGLSKSLVPVERHGGLSHDINITYKLTGETGSYRYMAPECFRHEPYNLKVDVYSFAMIIFQLFETTQPFAGHDPVEAARNAAMLGARPGFPPRGKLTDTEMSMRRLIEDCWAADAEKRPTFEEIIQRLEAQLARLPKHQHFEKDAA

HMMPanther: PTHR23257
59-459 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

MDYDRRTPLHVSAAEGAYSVVEWLVQEGADVNAIDRHGRTPLEEAARNDHGEVVRLLIQHGANVFEENKLVALDKSKLRGIVNTRRIMMNELGWEPEWEVNPKELQLVERIGSGEFGDVYKAKWHGSYVAAKLLKRSDEIAIGDFRTEIAILRKIHHPNCTQFLGACTKQKPYIVITELMACSLADAFQRTFYTPSTRRQVEIALDFARGMAYLHSRRQPIVHRDLKPANLMIAGNLHADTEQLYLDSGVIKVADFGLSKSLVPVERHGGLSHDINITYKLTGETGSYRYMAPECFRHEPYNLKVDVYSFAMIIFQLFETTQPFAGHDPVEAARNAAMLGARPGFPPRGKLTDTEMSMRRLIEDCWAADAEKRPTFEEIIQRLEAQLARLPKHQHFEKDAA

HMMSmart: SM00248
IPR002110
62-91 ankyrin repeats
Ankyrin repeat

DRRTPLHVSAAEGAYSVVEWLVQEGADVNA

ProfileScan: PS50088
IPR002110
62-94 ANK_REPEAT
Ankyrin repeat

DRRTPLHVSAAEGAYSVVEWLVQEGADVNAIDR

ProfileScan: PS50297
IPR020683
62-127 ANK_REP_REGION
Ankyrin repeat-containing domain

DRRTPLHVSAAEGAYSVVEWLVQEGADVNAIDRHGRTPLEEAARNDHGEVVRLLIQHGANVFEENK

HMMSmart: SM00248
IPR002110
95-124 ankyrin repeats
Ankyrin repeat

HGRTPLEEAARNDHGEVVRLLIQHGANVFE

ProfileScan: PS50088
IPR002110
95-127 ANK_REPEAT
Ankyrin repeat

HGRTPLEEAARNDHGEVVRLLIQHGANVFEENK

superfamily: SSF56112
IPR011009
149-439 Protein kinase-like (PK-like)
Protein kinase-like domain

ELGWEPEWEVNPKELQLVERIGSGEFGDVYKAKWHGSYVAAKLLKRSDEIAIGDFRTEIAILRKIHHPNCTQFLGACTKQKPYIVITELMACSLADAFQRTFYTPSTRRQVEIALDFARGMAYLHSRRQPIVHRDLKPANLMIAGNLHADTEQLYLDSGVIKVADFGLSKSLVPVERHGGLSHDINITYKLTGETGSYRYMAPECFRHEPYNLKVDVYSFAMIIFQLFETTQPFAGHDPVEAARNAAMLGARPGFPPRGKLTDTEMSMRRLIEDCWAADAEKRPTFEEIIQ

Gene3D: G3DSA:3.30.200.20
153-223 no description

EPEWEVNPKELQLVERIGSGEFGDVYKAKWHGSYVAAKLLKRSDEIAIGDFRTEIAILRKIHHPNCTQFLG

ProfileScan: PS50011
IPR000719
163-454 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LQLVERIGSGEFGDVYKAKWHGSYVAAKLLKRSDEIAIGDFRTEIAILRKIHHPNCTQFLGACTKQKPYIVITELMACSLADAFQRTFYTPSTRRQVEIALDFARGMAYLHSRRQPIVHRDLKPANLMIAGNLHADTEQLYLDSGVIKVADFGLSKSLVPVERHGGLSHDINITYKLTGETGSYRYMAPECFRHEPYNLKVDVYSFAMIIFQLFETTQPFAGHDPVEAARNAAMLGARPGFPPRGKLTDTEMSMRRLIEDCWAADAEKRPTFEEIIQRLEAQLARLPKHQHF

HMMSmart: SM00220
IPR002290
163-445 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LQLVERIGSGEFGDVYKAKWHGSYVAAKLLKRSDEIAIGDFRTEIAILRKIHHPNCTQFLGACTKQKPYIVITELMACSLADAFQRTFYTPSTRRQVEIALDFARGMAYLHSRRQPIVHRDLKPANLMIAGNLHADTEQLYLDSGVIKVADFGLSKSLVPVERHGGLSHDINITYKLTGETGSYRYMAPECFRHEPYNLKVDVYSFAMIIFQLFETTQPFAGHDPVEAARNAAMLGARPGFPPRGKLTDTEMSMRRLIEDCWAADAEKRPTFEEIIQRLEAQL

HMMSmart: SM00219
IPR020635
163-441 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LQLVERIGSGEFGDVYKAKWHGSYVAAKLLKRSDEIAIGDFRTEIAILRKIHHPNCTQFLGACTKQKPYIVITELMACSLADAFQRTFYTPSTRRQVEIALDFARGMAYLHSRRQPIVHRDLKPANLMIAGNLHADTEQLYLDSGVIKVADFGLSKSLVPVERHGGLSHDINITYKLTGETGSYRYMAPECFRHEPYNLKVDVYSFAMIIFQLFETTQPFAGHDPVEAARNAAMLGARPGFPPRGKLTDTEMSMRRLIEDCWAADAEKRPTFEEIIQRL

HMMPfam: PF00069
IPR000719
164-439 Pkinase,Ser-thr
Protein kinase, catalytic domain

QLVERIGSGEFGDVYKAKWHGSYVAAKLLKRSDEIAIGDFRTEIAILRKIHHPNCTQFLGACTKQKPYIVITELMACSLADAFQRTFYTPSTRRQVEIALDFARGMAYLHSRRQPIVHRDLKPANLMIAGNLHADTEQLYLDSGVIKVADFGLSKSLVPVERHGGLSHDINITYKLTGETGSYRYMAPECFRHEPYNLKVDVYSFAMIIFQLFETTQPFAGHDPVEAARNAAMLGARPGFPPRGKLTDTEMSMRRLIEDCWAADAEKRPTFEEIIQ

PatternScan: PS00107
IPR017441
169-190 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGEFGDVYKAKWHGSYVAAK

Gene3D: G3DSA:1.10.510.10
224-448 no description

ACTKQKPYIVITELMACSLADAFQRTFYTPSTRRQVEIALDFARGMAYLHSRRQPIVHRDLKPANLMIAGNLHADTEQLYLDSGVIKVADFGLSKSLVPVERHGGLSHDINITYKLTGETGSYRYMAPECFRHEPYNLKVDVYSFAMIIFQLFETTQPFAGHDPVEAARNAAMLGARPGFPPRGKLTDTEMSMRRLIEDCWAADAEKRPTFEEIIQRLEAQLARL

PatternScan: PS00108
IPR008271
279-291 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKPANLMI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox