PRGDB00150858 (Cucsa.006320.1)

From PRG Wiki
Jump to: navigation, search
Cucsa.006320.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGGGTTTCTCCCTTGGTACTTGTTCTATCCAAAGGGAGACCCCTCTTGAGTTAGATCATCACCATTGTCGCTATAATGAGCTTAAGATTAAAACCCTTTTGAGAAAAATGATTTGGGAACTTGGGTTCGCGTGTATTCTTCCTCCTGCTCGTTTTCGCCGCAAAAATCAGGGTATTCAAGATGAAGAACACCCAAATGTGGAGGGGCAAAACAAGAATCTAGAGCATAATAAAGCTTGGTTGCTTGCGGAGTCCGGTGCTGGTGGTGGGGAATTGTTAAATACTGATCCACAATCGGTTCATTCGTCTTTCCGGTTCAGTTTTTGCTCTCAGGTTGAACTTGAAACCATGAACATCGGCTCTTCAACCACTGCAGCAACTGTTTTAATGGTGAATTTGGATAATGGTATGATGGCTGAAGCTCTCACCAAAGAATTGAAATGGCGGAGGATTGAGTCTCTAGAAAAGAGCATTTCCCCTGTGGCTCATACTTTGATTAGATTCAGATATCGCGAAATTCTTTCTGCAACCCGCAATTTCTCAAAAGGCAGAGTTTTGGGAAGAGGGGCCTTAAGCTGTGTCTTCAGAGGAAGGGTTGGGTTTTTGAGAACCGCTGTGGCAATCAAACGTTTAGACAAGGAAGATAAAGAATCTGCAAAGGCATTCTGTAGAGAATTAATGATTGCTAGCTCTCTTCATAACCCAAATATAGTTCCTCTTGTTGGGTTTTGCATAGATCCAGAAGAGGGTCTGTTTTTGGTTTATAAATATGTTTCTGGTGGAAGTTTAGAAAGGCATTTGCATGAGAAGAAGAGGGGAATGAAGGGTCGTTTTTCTCTTCCCTGGTCAGTAAGATTCAAGATTGCTCTTGGAATTGCTGAGGCTGTGGCTTATCTTCACAATGGGACTGAAAGATGTGTTGTTCATAGAGACATCAAGCCTTCAAATATTCTTCTTACATCCAAGAAAATGCCAAAGTTATGTGATTTCGGGTTAGCAACATGGACTGCTGCTCCATCTGTGCCTTTCCTTTGCAAAACTGTCAAAGGAACATTTGGTTACCTAGCTCCTGAATATTTCCAACATGGGAAGGTATCAGATAAAACAGATGTCTATGCTGTAGGAGTTGTGTTATTGGAACTCATAACAGGCAGGAAGCCGTTCGAAGCAAGGGCACATGGAGAGGAGAACTTGGTTTTATGGGCAAAGCCACTGTTGCAGAAAGGGAAAGGGGCGATTACGGAGCTGCTTGATCCACAGGTGACATGTACGACAAAGAATTCAAATCAAATAGTTCAAATGATCGAAGCTGCTGCTGCTTGCATTACTGGTGAAGAATCACGCAGGCCGGGGATATTAGAGATCATTGCTATATTGAAAGGGGAAGAAAAGGCGCCTCTGCCCTCCAGATCAAAGAGGTACAGCTTCTTAGGACATGGATGTGTCACTGATTGTTATTCACAGTTTCAAAATACAAACAGCGAGATGACGGGTCATTTAGCGTTGGCCATGTCTGGACTACCCGAATTTGAAGATGACGATTACCTTTTCTGTCGTTGA


Protein sequences

Name Description Sequence
Cucsa.006320.1 Protein kinase superfamily protein (best arabidopsis hit)

MGFSLGTCSIQRETPLELDHHHCRYNELKIKTLLRKMIWELGFACILPPARFRRKNQGIQDEEHPNVEGQNKNLEHNKAWLLAESGAGGGELLNTDPQSVHSSFRFSFCSQVELETMNIGSSTTAATVLMVNLDNGMMAEALTKELKWRRIESLEKSISPVAHTLIRFRYREILSATRNFSKGRVLGRGALSCVFRGRVGFLRTAVAIKRLDKEDKESAKAFCRELMIASSLHNPNIVPLVGFCIDPEEGLFLVYKYVSGGSLERHLHEKKRGMKGRFSLPWSVRFKIALGIAEAVAYLHNGTERCVVHRDIKPSNILLTSKKMPKLCDFGLATWTAAPSVPFLCKTVKGTFGYLAPEYFQHGKVSDKTDVYAVGVVLLELITGRKPFEARAHGEENLVLWAKPLLQKGKGAITELLDPQVTCTTKNSNQIVQMIEAAAACITGEESRRPGILEIIAILKGEEKAPLPSRSKRYSFLGHGCVTDCYSQFQNTNSEMTGHLALAMSGLPEFEDDDYLFCR*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF656
75-516 PROTEIN KINASE FAMILY PROTEIN

EHNKAWLLAESGAGGGELLNTDPQSVHSSFRFSFCSQVELETMNIGSSTTAATVLMVNLDNGMMAEALTKELKWRRIESLEKSISPVAHTLIRFRYREILSATRNFSKGRVLGRGALSCVFRGRVGFLRTAVAIKRLDKEDKESAKAFCRELMIASSLHNPNIVPLVGFCIDPEEGLFLVYKYVSGGSLERHLHEKKRGMKGRFSLPWSVRFKIALGIAEAVAYLHNGTERCVVHRDIKPSNILLTSKKMPKLCDFGLATWTAAPSVPFLCKTVKGTFGYLAPEYFQHGKVSDKTDVYAVGVVLLELITGRKPFEARAHGEENLVLWAKPLLQKGKGAITELLDPQVTCTTKNSNQIVQMIEAAAACITGEESRRPGILEIIAILKGEEKAPLPSRSKRYSFLGHGCVTDCYSQFQNTNSEMTGHLALAMSGLPEFEDDDYL

HMMPanther: PTHR24420
75-516 FAMILY NOT NAMED,FAMILY NOT NAMED

EHNKAWLLAESGAGGGELLNTDPQSVHSSFRFSFCSQVELETMNIGSSTTAATVLMVNLDNGMMAEALTKELKWRRIESLEKSISPVAHTLIRFRYREILSATRNFSKGRVLGRGALSCVFRGRVGFLRTAVAIKRLDKEDKESAKAFCRELMIASSLHNPNIVPLVGFCIDPEEGLFLVYKYVSGGSLERHLHEKKRGMKGRFSLPWSVRFKIALGIAEAVAYLHNGTERCVVHRDIKPSNILLTSKKMPKLCDFGLATWTAAPSVPFLCKTVKGTFGYLAPEYFQHGKVSDKTDVYAVGVVLLELITGRKPFEARAHGEENLVLWAKPLLQKGKGAITELLDPQVTCTTKNSNQIVQMIEAAAACITGEESRRPGILEIIAILKGEEKAPLPSRSKRYSFLGHGCVTDCYSQFQNTNSEMTGHLALAMSGLPEFEDDDYL

Seg: seg
81-93 seg

LLAESGAGGGELL

superfamily: SSF56112
IPR011009
152-459 Protein kinase-like (PK-like)
Protein kinase-like domain

ESLEKSISPVAHTLIRFRYREILSATRNFSKGRVLGRGALSCVFRGRVGFLRTAVAIKRLDKEDKESAKAFCRELMIASSLHNPNIVPLVGFCIDPEEGLFLVYKYVSGGSLERHLHEKKRGMKGRFSLPWSVRFKIALGIAEAVAYLHNGTERCVVHRDIKPSNILLTSKKMPKLCDFGLATWTAAPSVPFLCKTVKGTFGYLAPEYFQHGKVSDKTDVYAVGVVLLELITGRKPFEARAHGEENLVLWAKPLLQKGKGAITELLDPQVTCTTKNSNQIVQMIEAAAACITGEESRRPGILEIIAIL

Gene3D: G3DSA:3.30.200.20
163-243 no description

HTLIRFRYREILSATRNFSKGRVLGRGALSCVFRGRVGFLRTAVAIKRLDKEDKESAKAFCRELMIASSLHNPNIVPLVGF

HMMSmart: SM00220
IPR002290
180-458 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSKGRVLGRGALSCVFRGRVGFLRTAVAIKRLDKEDKESAKAFCRELMIASSLHNPNIVPLVGFCIDPEEGLFLVYKYVSGGSLERHLHEKKRGMKGRFSLPWSVRFKIALGIAEAVAYLHNGTERCVVHRDIKPSNILLTSKKMPKLCDFGLATWTAAPSVPFLCKTVKGTFGYLAPEYFQHGKVSDKTDVYAVGVVLLELITGRKPFEARAHGEENLVLWAKPLLQKGKGAITELLDPQVTCTTKNSNQIVQMIEAAAACITGEESRRPGILEIIAI

ProfileScan: PS50011
IPR000719
180-477 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSKGRVLGRGALSCVFRGRVGFLRTAVAIKRLDKEDKESAKAFCRELMIASSLHNPNIVPLVGFCIDPEEGLFLVYKYVSGGSLERHLHEKKRGMKGRFSLPWSVRFKIALGIAEAVAYLHNGTERCVVHRDIKPSNILLTSKKMPKLCDFGLATWTAAPSVPFLCKTVKGTFGYLAPEYFQHGKVSDKTDVYAVGVVLLELITGRKPFEARAHGEENLVLWAKPLLQKGKGAITELLDPQVTCTTKNSNQIVQMIEAAAACITGEESRRPGILEIIAILKGEEKAPLPSRSKRYSFL

HMMSmart: SM00219
IPR020635
180-459 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSKGRVLGRGALSCVFRGRVGFLRTAVAIKRLDKEDKESAKAFCRELMIASSLHNPNIVPLVGFCIDPEEGLFLVYKYVSGGSLERHLHEKKRGMKGRFSLPWSVRFKIALGIAEAVAYLHNGTERCVVHRDIKPSNILLTSKKMPKLCDFGLATWTAAPSVPFLCKTVKGTFGYLAPEYFQHGKVSDKTDVYAVGVVLLELITGRKPFEARAHGEENLVLWAKPLLQKGKGAITELLDPQVTCTTKNSNQIVQMIEAAAACITGEESRRPGILEIIAIL

HMMPfam: PF00069
IPR000719
181-403 Pkinase,Ser-thr
Protein kinase, catalytic domain

SKGRVLGRGALSCVFRGRVGFLRTAVAIKRLDKEDKESAKAFCRELMIASSLHNPNIVPLVGFCIDPEEGLFLVYKYVSGGSLERHLHEKKRGMKGRFSLPWSVRFKIALGIAEAVAYLHNGTERCVVHRDIKPSNILLTSKKMPKLCDFGLATWTAAPSVPFLCKTVKGTFGYLAPEYFQHGKVSDKTDVYAVGVVLLELITGRKPFEARAHGEENLVLWAK

Gene3D: G3DSA:1.10.510.10
244-395 no description

CIDPEEGLFLVYKYVSGGSLERHLHEKKRGMKGRFSLPWSVRFKIALGIAEAVAYLHNGTERCVVHRDIKPSNILLTSKKMPKLCDFGLATWTAAPSVPFLCKTVKGTFGYLAPEYFQHGKVSDKTDVYAVGVVLLELITGRKPFEARAHGE

PatternScan: PS00108
IPR008271
307-319 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDIKPSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox