PRGDB00150859 (Cucsa.007350.1)

From PRG Wiki
Jump to: navigation, search
Cucsa.007350.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

mitogen-activated protein kinase kinase kinase 15 (best arabidopsis hit)

DNA Sequence

ATGGACTGGACCAGAGGCCCCCCCGTCGGCCGCGGCTCCTCCGCCACCGTCTATATGGCTACAATCAACTCATCCGGCCAACAATTCGCCGTCAAATCCACCGACTTTGCATCATCGGCTCTGTTGCAGAAGGAACACGCTCTTCTCTCCAATTTGAGCTCCCCATACCTAATTAAGTCCCTAGGTTTCGACGTTGAAACCCAACCCTTCAATCCCCCGGTGTTCAATCTCTTCATGGAGTATTTGCCGGAGGGGACTCTGTGGGACGCGATTCAGAGCAACGGCGGTCGAATTGAGGAATCGATGATCCGAGTGTTTTCGCGGCAGATTCTCAAAGGATTGGACTACCTTCATGCTAATGGATTGGCACATTGCGATATCAAGAGCCGGAATCTGTTACTGAGTGATGGGGATTTGAAAATTGCCGATCTAGGTTGTGCGAAATTTGTGGATGGAATTTCCGGTAATGGAGTTGGGGCTTTTTCTGGTTCGCCGGCGTTCATGGCGCCGGAAGTTGCAAGAGGTGAAGAACAGGGATTTCCGGCCGATGTTTGGGCTTTTGGATGTACAGTCATTGAAATGGCTACTGGGGATCATCCATGGCCGGAAATAGAGGATCCGGTTTCGGCGTTGTATCGGATTGGATTTTCCGGCGAGTTACCAGAGATTCCGCGGTGGTTGTCGGAAATTGCGAGGGATTTTGTCGCCAAGTGTTTGATAAAAGACTCGAAAGAAAGATGGAGTGTGAAACGGCTTCTCGAGCATCCGTTTCTTCAAGAACTTGATTCTGAATCGGAAATTGAAGGGTCGAGGATGAAAATGGTGAATTCTTCTTCTCCGAGCTGTGTTTTGGATCAGAGGTTTTGGGATTCAATGGAAGATTTGGAGACTCCATGGAAGGTGACTCAACAAGCTTCTTTGGTGGATTGTCCAGCTGAGAGGATTAGAAGGTTGGCTGATAATTTCTCTTGCGATTTGGAATTGGAATGGGATGATGGAGACTGGGTTTTGATCAGAAACAATGGGGTCGGCGGTGGAAGCCATGGAAATGGATCTGTGAGCATAGATTTTTGTGCTACAGTTGAAGAAGAAGATGAAAATTTGAACTCGGAAATTGAAGAAAATTCTGTATTGTTCTGTTTAGTTGATGATGATTTTAGTGTTGTGAACAGTAGGAAAGGAGGATTACAAATGGAATTAAAGATGAAAATTGAAAGGATTAAAAAGTAA


Protein sequences

Name Description Sequence
Cucsa.007350.1 mitogen-activated protein kinase kinase kinase 15 (best arabidopsis hit)

MDWTRGPPVGRGSSATVYMATINSSGQQFAVKSTDFASSALLQKEHALLSNLSSPYLIKSLGFDVETQPFNPPVFNLFMEYLPEGTLWDAIQSNGGRIEESMIRVFSRQILKGLDYLHANGLAHCDIKSRNLLLSDGDLKIADLGCAKFVDGISGNGVGAFSGSPAFMAPEVARGEEQGFPADVWAFGCTVIEMATGDHPWPEIEDPVSALYRIGFSGELPEIPRWLSEIARDFVAKCLIKDSKERWSVKRLLEHPFLQELDSESEIEGSRMKMVNSSSPSCVLDQRFWDSMEDLETPWKVTQQASLVDCPAERIRRLADNFSCDLELEWDDGDWVLIRNNGVGGGSHGNGSVSIDFCATVEEEDENLNSEIEENSVLFCLVDDDFSVVNSRKGGLQMELKMKIERIKK*

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
2-309 Protein kinase-like (PK-like)
Protein kinase-like domain

DWTRGPPVGRGSSATVYMATINSSGQQFAVKSTDFASSALLQKEHALLSNLSSPYLIKSLGFDVETQPFNPPVFNLFMEYLPEGTLWDAIQSNGGRIEESMIRVFSRQILKGLDYLHANGLAHCDIKSRNLLLSDGDLKIADLGCAKFVDGISGNGVGAFSGSPAFMAPEVARGEEQGFPADVWAFGCTVIEMATGDHPWPEIEDPVSALYRIGFSGELPEIPRWLSEIARDFVAKCLIKDSKERWSVKRLLEHPFLQELDSESEIEGSRMKMVNSSSPSCVLDQRFWDSMEDLETPWKVTQQASLVD

ProfileScan: PS50011
IPR000719
3-258 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

WTRGPPVGRGSSATVYMATINSSGQQFAVKSTDFASSALLQKEHALLSNLSSPYLIKSLGFDVETQPFNPPVFNLFMEYLPEGTLWDAIQSNGGRIEESMIRVFSRQILKGLDYLHANGLAHCDIKSRNLLLSDGDLKIADLGCAKFVDGISGNGVGAFSGSPAFMAPEVARGEEQGFPADVWAFGCTVIEMATGDHPWPEIEDPVSALYRIGFSGELPEIPRWLSEIARDFVAKCLIKDSKERWSVKRLLEHPFL

HMMPanther: PTHR24361
3-407 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

WTRGPPVGRGSSATVYMATINSSGQQFAVKSTDFASSALLQKEHALLSNLSSPYLIKSLGFDVETQPFNPPVFNLFMEYLPEGTLWDAIQSNGGRIEESMIRVFSRQILKGLDYLHANGLAHCDIKSRNLLLSDGDLKIADLGCAKFVDGISGNGVGAFSGSPAFMAPEVARGEEQGFPADVWAFGCTVIEMATGDHPWPEIEDPVSALYRIGFSGELPEIPRWLSEIARDFVAKCLIKDSKERWSVKRLLEHPFLQELDSESEIEGSRMKMVNSSSPSCVLDQRFWDSMEDLETPWKVTQQASLVDCPAERIRRLADNFSCDLELEWDDGDWVLIRNNGVGGGSHGNGSVSIDFCATVEEEDENLNSEIEENSVLFCLVDDDFSVVNSRKGGLQMELKMKIERI

HMMSmart: SM00220
IPR002290
3-258 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

WTRGPPVGRGSSATVYMATINSSGQQFAVKSTDFASSALLQKEHALLSNLSSPYLIKSLGFDVETQPFNPPVFNLFMEYLPEGTLWDAIQSNGGRIEESMIRVFSRQILKGLDYLHANGLAHCDIKSRNLLLSDGDLKIADLGCAKFVDGISGNGVGAFSGSPAFMAPEVARGEEQGFPADVWAFGCTVIEMATGDHPWPEIEDPVSALYRIGFSGELPEIPRWLSEIARDFVAKCLIKDSKERWSVKRLLEHPFL

HMMPanther: PTHR24361:SF58
3-407 SUBFAMILY NOT NAMED

WTRGPPVGRGSSATVYMATINSSGQQFAVKSTDFASSALLQKEHALLSNLSSPYLIKSLGFDVETQPFNPPVFNLFMEYLPEGTLWDAIQSNGGRIEESMIRVFSRQILKGLDYLHANGLAHCDIKSRNLLLSDGDLKIADLGCAKFVDGISGNGVGAFSGSPAFMAPEVARGEEQGFPADVWAFGCTVIEMATGDHPWPEIEDPVSALYRIGFSGELPEIPRWLSEIARDFVAKCLIKDSKERWSVKRLLEHPFLQELDSESEIEGSRMKMVNSSSPSCVLDQRFWDSMEDLETPWKVTQQASLVDCPAERIRRLADNFSCDLELEWDDGDWVLIRNNGVGGGSHGNGSVSIDFCATVEEEDENLNSEIEENSVLFCLVDDDFSVVNSRKGGLQMELKMKIERI

HMMSmart: SM00219
IPR020635
3-258 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

WTRGPPVGRGSSATVYMATINSSGQQFAVKSTDFASSALLQKEHALLSNLSSPYLIKSLGFDVETQPFNPPVFNLFMEYLPEGTLWDAIQSNGGRIEESMIRVFSRQILKGLDYLHANGLAHCDIKSRNLLLSDGDLKIADLGCAKFVDGISGNGVGAFSGSPAFMAPEVARGEEQGFPADVWAFGCTVIEMATGDHPWPEIEDPVSALYRIGFSGELPEIPRWLSEIARDFVAKCLIKDSKERWSVKRLLEHPFL

HMMPfam: PF00069
IPR000719
6-258 Pkinase,Ser-thr
Protein kinase, catalytic domain

GPPVGRGSSATVYMATINSSGQQFAVKSTDFASSALLQKEHALLSNLSSPYLIKSLGFDVETQPFNPPVFNLFMEYLPEGTLWDAIQSNGGRIEESMIRVFSRQILKGLDYLHANGLAHCDIKSRNLLLSDGDLKIADLGCAKFVDGISGNGVGAFSGSPAFMAPEVARGEEQGFPADVWAFGCTVIEMATGDHPWPEIEDPVSALYRIGFSGELPEIPRWLSEIARDFVAKCLIKDSKERWSVKRLLEHPFL

Gene3D: G3DSA:3.30.200.20
7-90 no description

PPVGRGSSATVYMATINSSGQQFAVKSTDFASSALLQKEHALLSNLSSPYLIKSLGFDVETQPFNPPVFNLFMEYLPEGTLWDA

PatternScan: PS00107
IPR017441
9-32 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGRGSSATVYMATINSSGQQFAVK

Gene3D: G3DSA:1.10.510.10
91-281 no description

IQSNGGRIEESMIRVFSRQILKGLDYLHANGLAHCDIKSRNLLLSDGDLKIADLGCAKFVDGISGNGVGAFSGSPAFMAPEVARGEEQGFPADVWAFGCTVIEMATGDHPWPEIEDPVSALYRIGFSGELPEIPRWLSEIARDFVAKCLIKDSKERWSVKRLLEHPFLQELDSESEIEGSRMKMVNSSSPS

PatternScan: PS00108
IPR008271
122-134 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

LAHCDIKSRNLLL

Seg: seg
340-354 seg

NNGVGGGSHGNGSVS

Seg: seg
362-375 seg

EEEDENLNSEIEEN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox