PRGDB00150860 (Cucsa.007840.1)

From PRG Wiki
Jump to: navigation, search
Cucsa.007840.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

SOS3-interacting protein 4 (best arabidopsis hit)

DNA Sequence

ATGCCGGAGATCGAACCATCTTCCCCCGACAGCAATGCCCTCTTCGGCAAATACGAGCTCGGCAAGCTCCTCGGCTGCGGCGCCTTTGCCAAGGTCTACCATGCTCGCGACCTCCGCTCCGGCCAAAGCGTCGCCGTTAAGGTTATCAACAAGAAGAAGATCTACGGCACAACCTTGATGTTCAACATTAAGCGAGAGATCGCCATTATGCGCCGTCTCCGTCATCCTAACATCGTTAAACTCCATGAGGTTCTCGCTACCAAATCTAAGATCTACTTCGTTATGGAGTTCGTCAAAGGCGGCGAGCTTTTCGCTAAGATCGCCAAGGGCAGATTCAGTGAAGATCTCAGCCGGAGATTCTTCCACCAGCTGATCTCCGCCGTTGGATTCTGTCATACGCGTGGGATTTACCACCGCGATCTGAAGCCGGAGAATCTTCTCGTCGATGAGAACGGGAATCTTAAGGTCTCTGACTTTGGTCTCAGTGCGGTTACGGAACAGATCCGTGCCGATGGCCTTTTGCACACTCTTTGTGGAACTCCGGCCTATGTCGCGCCGGAGATTTTGTCCAAAAAGGGATACGACGGTGCGAAGGTTGATGTGTGGTCATGTGGTGTGATTCTTTTCGTGTTGAGCGCCGGTTACCTTCCCTTCAACGATCCGAATCTCATGGCCATGTATAAGAAGATTTACAAGGGGGAATATCGGTGCCCTAAATGGATGTCGTCGGATCTCAAGAGGTTTCTGTCGCGACTTCTAGATACGAATCCTGATTCGAGGATAACCATCGAAGAAATTCTTAATGATCCATGGTTCAGAAAAGGAGGAAATACAGAGATCAACTTCTACGATGATTACGAGATGAAATCAGAAGAGAAAGACGAATCTCCATCGACGGATTTGAATGCATTCGACATTATATCTTTCTCATCTGGATTGAATCTGTCTGGTTTGTTCGATAATTCACAAAACGTTATGGATGACAGTGATCGATTCATATCGGCAGAGTCACCGGAGAAGATCGTGGAAAAAATTGAGAAATTCGGCAAGGCTGAGGATTTAAAGGTGAAGAAACAGAAAGAGTTTGGATTTGAATTGGATGCAAAGAATCGTGTTTTGGTAATCGGAATAGAACTTTTCCGGTTAACAGACGAATTGGTGGTGGTGGAGATGAGAAGAAGATGCGGAGATTCAGAATCGTATAAGAAAATGTTGAAGAAGAAGCTGAAAATCCATCTAACCGGCGATGACGCGTCGACGTCGACTTCCCAATAG


Protein sequences

Name Description Sequence
Cucsa.007840.1 SOS3-interacting protein 4 (best arabidopsis hit)

MPEIEPSSPDSNALFGKYELGKLLGCGAFAKVYHARDLRSGQSVAVKVINKKKIYGTTLMFNIKREIAIMRRLRHPNIVKLHEVLATKSKIYFVMEFVKGGELFAKIAKGRFSEDLSRRFFHQLISAVGFCHTRGIYHRDLKPENLLVDENGNLKVSDFGLSAVTEQIRADGLLHTLCGTPAYVAPEILSKKGYDGAKVDVWSCGVILFVLSAGYLPFNDPNLMAMYKKIYKGEYRCPKWMSSDLKRFLSRLLDTNPDSRITIEEILNDPWFRKGGNTEINFYDDYEMKSEEKDESPSTDLNAFDIISFSSGLNLSGLFDNSQNVMDDSDRFISAESPEKIVEKIEKFGKAEDLKVKKQKEFGFELDAKNRVLVIGIELFRLTDELVVVEMRRRCGDSESYKKMLKKKLKIHLTGDDASTSTSQ*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24343
1-346 FAMILY NOT NAMED,SERINE/THREONINE KINASE

MPEIEPSSPDSNALFGKYELGKLLGCGAFAKVYHARDLRSGQSVAVKVINKKKIYGTTLMFNIKREIAIMRRLRHPNIVKLHEVLATKSKIYFVMEFVKGGELFAKIAKGRFSEDLSRRFFHQLISAVGFCHTRGIYHRDLKPENLLVDENGNLKVSDFGLSAVTEQIRADGLLHTLCGTPAYVAPEILSKKGYDGAKVDVWSCGVILFVLSAGYLPFNDPNLMAMYKKIYKGEYRCPKWMSSDLKRFLSRLLDTNPDSRITIEEILNDPWFRKGGNTEINFYDDYEMKSEEKDESPSTDLNAFDIISFSSGLNLSGLFDNSQNVMDDSDRFISAESPEKIVEKIE

HMMPanther: PTHR24343:SF45
1-346 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PTK1

MPEIEPSSPDSNALFGKYELGKLLGCGAFAKVYHARDLRSGQSVAVKVINKKKIYGTTLMFNIKREIAIMRRLRHPNIVKLHEVLATKSKIYFVMEFVKGGELFAKIAKGRFSEDLSRRFFHQLISAVGFCHTRGIYHRDLKPENLLVDENGNLKVSDFGLSAVTEQIRADGLLHTLCGTPAYVAPEILSKKGYDGAKVDVWSCGVILFVLSAGYLPFNDPNLMAMYKKIYKGEYRCPKWMSSDLKRFLSRLLDTNPDSRITIEEILNDPWFRKGGNTEINFYDDYEMKSEEKDESPSTDLNAFDIISFSSGLNLSGLFDNSQNVMDDSDRFISAESPEKIVEKIE

superfamily: SSF56112
IPR011009
4-303 Protein kinase-like (PK-like)
Protein kinase-like domain

IEPSSPDSNALFGKYELGKLLGCGAFAKVYHARDLRSGQSVAVKVINKKKIYGTTLMFNIKREIAIMRRLRHPNIVKLHEVLATKSKIYFVMEFVKGGELFAKIAKGRFSEDLSRRFFHQLISAVGFCHTRGIYHRDLKPENLLVDENGNLKVSDFGLSAVTEQIRADGLLHTLCGTPAYVAPEILSKKGYDGAKVDVWSCGVILFVLSAGYLPFNDPNLMAMYKKIYKGEYRCPKWMSSDLKRFLSRLLDTNPDSRITIEEILNDPWFRKGGNTEINFYDDYEMKSEEKDESPSTDLNA

Gene3D: G3DSA:3.30.200.20
10-114 no description

DSNALFGKYELGKLLGCGAFAKVYHARDLRSGQSVAVKVINKKKIYGTTLMFNIKREIAIMRRLRHPNIVKLHEVLATKSKIYFVMEFVKGGELFAKIAKGRFSE

HMMSmart: SM00219
IPR020635
18-270 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YELGKLLGCGAFAKVYHARDLRSGQSVAVKVINKKKIYGTTLMFNIKREIAIMRRLRHPNIVKLHEVLATKSKIYFVMEFVKGGELFAKIAKGRFSEDLSRRFFHQLISAVGFCHTRGIYHRDLKPENLLVDENGNLKVSDFGLSAVTEQIRADGLLHTLCGTPAYVAPEILSKKGYDGAKVDVWSCGVILFVLSAGYLPFNDPNLMAMYKKIYKGEYRCPKWMSSDLKRFLSRLLDTNPDSRITIEEILNDP

HMMSmart: SM00220
IPR002290
18-272 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YELGKLLGCGAFAKVYHARDLRSGQSVAVKVINKKKIYGTTLMFNIKREIAIMRRLRHPNIVKLHEVLATKSKIYFVMEFVKGGELFAKIAKGRFSEDLSRRFFHQLISAVGFCHTRGIYHRDLKPENLLVDENGNLKVSDFGLSAVTEQIRADGLLHTLCGTPAYVAPEILSKKGYDGAKVDVWSCGVILFVLSAGYLPFNDPNLMAMYKKIYKGEYRCPKWMSSDLKRFLSRLLDTNPDSRITIEEILNDPWF

ProfileScan: PS50011
IPR000719
18-272 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YELGKLLGCGAFAKVYHARDLRSGQSVAVKVINKKKIYGTTLMFNIKREIAIMRRLRHPNIVKLHEVLATKSKIYFVMEFVKGGELFAKIAKGRFSEDLSRRFFHQLISAVGFCHTRGIYHRDLKPENLLVDENGNLKVSDFGLSAVTEQIRADGLLHTLCGTPAYVAPEILSKKGYDGAKVDVWSCGVILFVLSAGYLPFNDPNLMAMYKKIYKGEYRCPKWMSSDLKRFLSRLLDTNPDSRITIEEILNDPWF

HMMPfam: PF00069
IPR000719
18-272 Pkinase,Ser-thr
Protein kinase, catalytic domain

YELGKLLGCGAFAKVYHARDLRSGQSVAVKVINKKKIYGTTLMFNIKREIAIMRRLRHPNIVKLHEVLATKSKIYFVMEFVKGGELFAKIAKGRFSEDLSRRFFHQLISAVGFCHTRGIYHRDLKPENLLVDENGNLKVSDFGLSAVTEQIRADGLLHTLCGTPAYVAPEILSKKGYDGAKVDVWSCGVILFVLSAGYLPFNDPNLMAMYKKIYKGEYRCPKWMSSDLKRFLSRLLDTNPDSRITIEEILNDPWF

PatternScan: PS00107
IPR017441
24-47 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGCGAFAKVYHARDLRSGQSVAVK

Gene3D: G3DSA:1.10.510.10
115-295 no description

DLSRRFFHQLISAVGFCHTRGIYHRDLKPENLLVDENGNLKVSDFGLSAVTEQIRADGLLHTLCGTPAYVAPEILSKKGYDGAKVDVWSCGVILFVLSAGYLPFNDPNLMAMYKKIYKGEYRCPKWMSSDLKRFLSRLLDTNPDSRITIEEILNDPWFRKGGNTEINFYDDYEMKSEEKDE

PatternScan: PS00108
IPR008271
136-148 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IYHRDLKPENLLV

ProfileScan: PS50816
IPR018451
296-320 NAF
NAF/FISL domain

SPSTDLNAFDIISFSSGLNLSGLFD

HMMPfam: PF03822
IPR004041
299-358 NAF
NAF domain

TDLNAFDIISFSSGLNLSGLFDNSQNVMDDSDRFISAESPEKIVEKIEKFGKAEDLKVKK

Seg: seg
308-322 seg

SFSSGLNLSGLFDNS

Seg: seg
402-410 seg

KKMLKKKLK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox