PRGDB00150861 (Cucsa.007850.1)

From PRG Wiki
Jump to: navigation, search
Cucsa.007850.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

SOS3-interacting protein 1 (best arabidopsis hit)

DNA Sequence

ATGGAAAATAAGGCGAGTGTGATGGTTCAACGATATGAATTAGGGAGATTGCTTGGCCAAGGAACGTTTGCGAAGGTATATTATGCGAGGAATACAGGAAGCAACCAAAGTGTGGCCATTAAGGTGATTGATAAGGAAAAGATTACCAAGGCTTCACTAATCGATCAGATTAAGCGTGAAATATCTATTATGAGACTTGTTAGACATCCCAATATTCTTCGTCTATATGAGGTTATGGCTACCAAGACTAAGATCTACTTTGTTTTGGAATATGCCAAAGGTGGTGAGCTCTTTGATAAGGTTGCTAAAGGGAAGCTGAAGGAGGACGTTGCTTGGAAATACTTTTATCAGTTAATTAATGCTGTTGATTTTTGTCACAGTAGGGGAGTGTATCACCGCGATATAAAGCCAGAGAACCTACTGCTTGATGAAAATGAGAATCTTAAGGTGTCTGATTTTGGTTTAAGTGCTTTAGCTGAGTCCAAGCGTCAAGACGGTTTGCTACACACGACTTGTGGAACACCAGCTTATGTTGCTCCTGAAGTCATCAATAGGAAGGGCTATGATGGTGCCAAAGCTGATATCTGGTCTTGTGGAGTAGTTTTGTTTGTCCTATTGGCAGGTTATCTCCCATTCCACAATTCGAATTTGATGGAAATGTATAGGAAGATCGGAAAAGCAGAGTATAAATGCCCCAGTTGGTTTCCTCGTGAAGTGCGGCGGCTGCTAAGCAGGATGCTTGATCCAGACCCCAATACTAGGACTTCAATAGCATTGATAAGACAAAGTTCTTGGTTCAAAAAGGGATTGAGGTCTAAGAATGCAAGAAGTGGGGTAGAAAGCAATGCTGTAGCACCTGAAGATGCCACGGCTGGTTCCGGACCATCTGAGGGAAGTGTGGCAGCAGATGGAAATCAAGAGCCAGATAGACCTCCAACTTTGAATGCTTTCGATATCATCTCCCTTTCCGCTGGCTTCAATTTATCCAGTTTATTTGAAGACAATTCAAAGAAGAAAGAAACATTGTTTACTTGTAGAAAACCAGCCTCTGTTATTCTCTCAAAACTAGAAGAAATGGCTAAACTTCTTCGGTTTCGAGTACAGAAGAAGGAAGCAGGCCTATTAAAGTTTGAGGCGCTAACAGAGGGAAAAAAGGGGGCATTATCCATTGATACAGAGATCTTTGAGGTTACTCCATCTTTTTATTTAGTGGAAATGAAAAAATCAAATGGAGACACATTGGAATATCAGAAGGTATTGAAAGAAGACATTAGGCCAGCTCTAAAAGATATAGTATGGGTTTGGCGAGGAGAGCAAGAACAGCAGCAACAAGATCCACAGCCTCAGCCTCTCCAGCCACAGGATCAAGTTCGAGATCCTTATCCAGAGCAAGATGGTGCATCACAACCGCAATAG


Protein sequences

Name Description Sequence
Cucsa.007850.1 SOS3-interacting protein 1 (best arabidopsis hit)

MENKASVMVQRYELGRLLGQGTFAKVYYARNTGSNQSVAIKVIDKEKITKASLIDQIKREISIMRLVRHPNILRLYEVMATKTKIYFVLEYAKGGELFDKVAKGKLKEDVAWKYFYQLINAVDFCHSRGVYHRDIKPENLLLDENENLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVINRKGYDGAKADIWSCGVVLFVLLAGYLPFHNSNLMEMYRKIGKAEYKCPSWFPREVRRLLSRMLDPDPNTRTSIALIRQSSWFKKGLRSKNARSGVESNAVAPEDATAGSGPSEGSVAADGNQEPDRPPTLNAFDIISLSAGFNLSSLFEDNSKKKETLFTCRKPASVILSKLEEMAKLLRFRVQKKEAGLLKFEALTEGKKGALSIDTEIFEVTPSFYLVEMKKSNGDTLEYQKVLKEDIRPALKDIVWVWRGEQEQQQQDPQPQPLQPQDQVRDPYPEQDGASQPQ*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24343
1-271 FAMILY NOT NAMED,SERINE/THREONINE KINASE

MENKASVMVQRYELGRLLGQGTFAKVYYARNTGSNQSVAIKVIDKEKITKASLIDQIKREISIMRLVRHPNILRLYEVMATKTKIYFVLEYAKGGELFDKVAKGKLKEDVAWKYFYQLINAVDFCHSRGVYHRDIKPENLLLDENENLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVINRKGYDGAKADIWSCGVVLFVLLAGYLPFHNSNLMEMYRKIGKAEYKCPSWFPREVRRLLSRMLDPDPNTRTSIALIRQSSWFKKGLR

HMMPanther: PTHR24343:SF45
1-271 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PTK1

MENKASVMVQRYELGRLLGQGTFAKVYYARNTGSNQSVAIKVIDKEKITKASLIDQIKREISIMRLVRHPNILRLYEVMATKTKIYFVLEYAKGGELFDKVAKGKLKEDVAWKYFYQLINAVDFCHSRGVYHRDIKPENLLLDENENLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVINRKGYDGAKADIWSCGVVLFVLLAGYLPFHNSNLMEMYRKIGKAEYKCPSWFPREVRRLLSRMLDPDPNTRTSIALIRQSSWFKKGLR

Gene3D: G3DSA:3.30.200.20
4-108 no description

KASVMVQRYELGRLLGQGTFAKVYYARNTGSNQSVAIKVIDKEKITKASLIDQIKREISIMRLVRHPNILRLYEVMATKTKIYFVLEYAKGGELFDKVAKGKLKE

superfamily: SSF56112
IPR011009
7-297 Protein kinase-like (PK-like)
Protein kinase-like domain

VMVQRYELGRLLGQGTFAKVYYARNTGSNQSVAIKVIDKEKITKASLIDQIKREISIMRLVRHPNILRLYEVMATKTKIYFVLEYAKGGELFDKVAKGKLKEDVAWKYFYQLINAVDFCHSRGVYHRDIKPENLLLDENENLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVINRKGYDGAKADIWSCGVVLFVLLAGYLPFHNSNLMEMYRKIGKAEYKCPSWFPREVRRLLSRMLDPDPNTRTSIALIRQSSWFKKGLRSKNARSGVESNAVAPEDATAGSGPSE

ProfileScan: PS50011
IPR000719
12-266 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YELGRLLGQGTFAKVYYARNTGSNQSVAIKVIDKEKITKASLIDQIKREISIMRLVRHPNILRLYEVMATKTKIYFVLEYAKGGELFDKVAKGKLKEDVAWKYFYQLINAVDFCHSRGVYHRDIKPENLLLDENENLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVINRKGYDGAKADIWSCGVVLFVLLAGYLPFHNSNLMEMYRKIGKAEYKCPSWFPREVRRLLSRMLDPDPNTRTSIALIRQSSWF

HMMPfam: PF00069
IPR000719
12-266 Pkinase,Ser-thr
Protein kinase, catalytic domain

YELGRLLGQGTFAKVYYARNTGSNQSVAIKVIDKEKITKASLIDQIKREISIMRLVRHPNILRLYEVMATKTKIYFVLEYAKGGELFDKVAKGKLKEDVAWKYFYQLINAVDFCHSRGVYHRDIKPENLLLDENENLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVINRKGYDGAKADIWSCGVVLFVLLAGYLPFHNSNLMEMYRKIGKAEYKCPSWFPREVRRLLSRMLDPDPNTRTSIALIRQSSWF

HMMSmart: SM00219
IPR020635
12-266 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YELGRLLGQGTFAKVYYARNTGSNQSVAIKVIDKEKITKASLIDQIKREISIMRLVRHPNILRLYEVMATKTKIYFVLEYAKGGELFDKVAKGKLKEDVAWKYFYQLINAVDFCHSRGVYHRDIKPENLLLDENENLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVINRKGYDGAKADIWSCGVVLFVLLAGYLPFHNSNLMEMYRKIGKAEYKCPSWFPREVRRLLSRMLDPDPNTRTSIALIRQSSWF

HMMSmart: SM00220
IPR002290
12-266 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YELGRLLGQGTFAKVYYARNTGSNQSVAIKVIDKEKITKASLIDQIKREISIMRLVRHPNILRLYEVMATKTKIYFVLEYAKGGELFDKVAKGKLKEDVAWKYFYQLINAVDFCHSRGVYHRDIKPENLLLDENENLKVSDFGLSALAESKRQDGLLHTTCGTPAYVAPEVINRKGYDGAKADIWSCGVVLFVLLAGYLPFHNSNLMEMYRKIGKAEYKCPSWFPREVRRLLSRMLDPDPNTRTSIALIRQSSWF

PatternScan: PS00107
IPR017441
18-41 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGTFAKVYYARNTGSNQSVAIK

PatternScan: PS00108
IPR008271
130-142 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDIKPENLLL

Seg: seg
138-148 seg

ENLLLDENENL

ProfileScan: PS50816
IPR018451
309-333 NAF
NAF/FISL domain

DRPPTLNAFDIISLSAGFNLSSLFE

HMMPfam: PF03822
IPR004041
311-369 NAF
NAF domain

PPTLNAFDIISLSAGFNLSSLFEDNSKKKETLFTCRKPASVILSKLEEMAKLLRFRVQK

Gene3D: G3DSA:1.10.510.10
435-436 no description

WR

Seg: seg
438-456 seg

EQEQQQQDPQPQPLQPQDQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox