PRGDB00150866 (Cucsa.009200.5)

From PRG Wiki
Jump to: navigation, search
Cucsa.009200.5
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGACTGAGGCTAAATTGTTGGCTCGAGTGCAGCACAGAAATGTCGTCAATTTGTTGGGATACTGTGTGCATGGTGCAGAGAAACTACTGGTTTACGAATACGTCATGAATGAGAGCCTCGACAAGCTTCTCTTTAAATCCAGCAGACGAGGAGAACTTGATTGGAAGAGGAGATATGACATAATCTTTGGCGTAGCACGAGGGTTGCAATATCTTCATGTAGACTCACATAACGTCATTATCCATCGTGACATAAAGGCTAGTAACATTTTGTTGGATGACAAATGGGTTCCTAAAATTGCGGATTTTGGCATGGCTCGTCTCTTCCCTGAAGATCAAACTCATGTCAATACTCGAGTTGCTGGTACAAATGGATATATGGCTCCCGAATATGTAATGCACGGGCATCTATCAGTAAAGGCAGACGTTTTTAGCTTTGGAGTTTTGGTTTTGGAACTTATAAGTGGCCAGCGAAATTCGTCATTTACTTCATTTATGGATGCGGAGAATCTACTTGATTGGGCTTACAAACTGTACAAGAAGGGAAGAAGCTTGGAGATCATGGACCCAACATTAGCATCATCAGCTGTTCCTGACCAAGTTACAATGTGCATTCAAATAGGATTGCTCTGCACACAAGGTGATTCACACCTACGGCCGACCATGCCACGTGTAGTTTTAATTCTTTCAAAGAGACCTGGTAATTTGGAGGAACCAACGAGACCGGGAATGCCCGGTTCTCGGTATAGAAGAACTCGTAGGACAAGTGCATCGTCCTCCATTGTGGGTACTTCGGGAACTTCGTCTGGTGTATCCGACTCCTATGCTTTGACAACCAATACTACTGGAACTATAACTGCTACGGCGACCGCAACCGCAACTGCAAATGAAGTTGCTTCTAGCTCTTCTCCAATTAGTCGAAGATACGATACTCGTGGGAAACGTCCAATAGAAGGTTAG


Protein sequences

Name Description Sequence
Cucsa.009200.5 Protein kinase superfamily protein (best arabidopsis hit)

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFKSSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLILSKRPGNLEEPTRPGMPGSRYRRTRRTSASSSIVGTSGTSSGVSDSYALTTNTTGTITATATATATANEVASSSSPISRRYDTRGKRPIEG*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-313 FAMILY NOT NAMED,FAMILY NOT NAMED

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFKSSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLILSKRPGNLEEPTRPGMPGSRYRRTRRTSASSSIVGTSGTSSGVSDSYALTTNTTGTITATATATATANEVASSSSPISRRYDTRG

ProfileScan: PS50011
IPR000719
1-235 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFKSSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLILSKRPGN

HMMPanther: PTHR24420:SF787
1-313 SUBFAMILY NOT NAMED

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFKSSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLILSKRPGNLEEPTRPGMPGSRYRRTRRTSASSSIVGTSGTSSGVSDSYALTTNTTGTITATATATATANEVASSSSPISRRYDTRG

superfamily: SSF56112
IPR011009
1-237 Protein kinase-like (PK-like)
Protein kinase-like domain

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFKSSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLILSKRPGNLE

HMMSmart: SM00220
IPR002290
1-228 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFKSSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLI

HMMSmart: SM00219
IPR020635
1-229 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

MTEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFKSSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVVLIL

Gene3D: G3DSA:3.30.200.20
2-42 no description

TEAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDK

HMMPfam: PF00069
IPR000719
3-163 Pkinase,Ser-thr
Protein kinase, catalytic domain

EAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLFKSSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFT

Gene3D: G3DSA:1.10.510.10
43-226 no description

LLFKSSRRGELDWKRRYDIIFGVARGLQYLHVDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNTRVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVLELISGQRNSSFTSFMDAENLLDWAYKLYKKGRSLEIMDPTLASSAVPDQVTMCIQIGLLCTQGDSHLRPTMPRVV

PatternScan: PS00108
IPR008271
80-92 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKASNILL

Seg: seg
247-274 seg

SRYRRTRRTSASSSIVGTSGTSSGVSDS

Seg: seg
276-295 seg

ALTTNTTGTITATATATATA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox