PRGDB00150868 (Cucsa.010850.1)

From PRG Wiki
Jump to: navigation, search
Cucsa.010850.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGGGATCTTGTGTTAGTGTTCCTGCAATCGACAATCGATCCCCTTTTCATGGAATCGATTCCAATGGTTCCACCTCCTCTGCTTCTGTTCATCCAAGTCCAAGAACAGAGGATGAGATTCTGCAGTCTCCAAATCTAAAGAGATTTTGCTTTAACGAACTCAAAAAGGCGACCGGTAACTTCCGACAACGGAGTATGGTGGGGGAAGGTGGGTTTGGGAGTGTGTTCAAGGGTTGGATTGATCACCACTCTCTTGCCGCTACCAAGCCTGGCTCCGGCATCGCGATTGCTGTCAAAAGACATAATCAAGAGGGCTTCCAAGGCCACAATGAATGGTTGGCGGAAATCAATTATTTGGGGCAGTTGCATCATCCAAATTTGGTGAAATTGATTGGTTATTGCTTGGAGAATGAGGATCAGCTTCTTGCTTATGAATTTATGTCAAAAGGAAGCTTGGATAATCACCTTTTTGGAAGAGGATCTGGATCTCAACCACTTTCATGGAAGTTGCGTATGAAAATTGCATTGGACGCAGCTAAAGGATTGGCGTATTTACATGGCAAAAAAGTTATCCATCGTGATTTCAAATCATCAAACATCTTGCTCGATGCGAATTATGATGCAAAGATATCGGACTTCGGATTAGCTAAGGACGGCCCGGTGGGAAATGAAAGTCATGTTTCTACAAGATGTATGGGCACTTATGGTTATGCAGCTCCTGAATATATGGCCACAGGTCATTTGACACCCAAGAGCGACGTATACAGTTTCGGAGCAGTTCTATTGGAGATACTATGCGGAAGACGAGCATTGGATGCGACAAAGGCAGGAAGAGAGCAAAACCTAGTAGAATGGGCAAAGCCAAATATTAGCAACAGAAGAATAATGAGAATTATGGACAATAGAATTGAGGGAGAATGTGGTGTAAAGAAGGCAATAACAGCAGCTAAACTTGCTTTTAAATGCCTCTCTGATGACCCAAAACATAGACCTTCAATGTATCAA


Protein sequences

Name Description Sequence
Cucsa.010850.1 Protein kinase superfamily protein (best arabidopsis hit)

MGSCVSVPAIDNRSPFHGIDSNGSTSSASVHPSPRTEDEILQSPNLKRFCFNELKKATGNFRQRSMVGEGGFGSVFKGWIDHHSLAATKPGSGIAIAVKRHNQEGFQGHNEWLAEINYLGQLHHPNLVKLIGYCLENEDQLLAYEFMSKGSLDNHLFGRGSGSQPLSWKLRMKIALDAAKGLAYLHGKKVIHRDFKSSNILLDANYDAKISDFGLAKDGPVGNESHVSTRCMGTYGYAAPEYMATGHLTPKSDVYSFGAVLLEILCGRRALDATKAGREQNLVEWAKPNISNRRIMRIMDNRIEGECGVKKAITAAKLAFKCLSDDPKHRPSMYQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF861
32-335 SUBFAMILY NOT NAMED

PSPRTEDEILQSPNLKRFCFNELKKATGNFRQRSMVGEGGFGSVFKGWIDHHSLAATKPGSGIAIAVKRHNQEGFQGHNEWLAEINYLGQLHHPNLVKLIGYCLENEDQLLAYEFMSKGSLDNHLFGRGSGSQPLSWKLRMKIALDAAKGLAYLHGKKVIHRDFKSSNILLDANYDAKISDFGLAKDGPVGNESHVSTRCMGTYGYAAPEYMATGHLTPKSDVYSFGAVLLEILCGRRALDATKAGREQNLVEWAKPNISNRRIMRIMDNRIEGECGVKKAITAAKLAFKCLSDDPKHRPSMYQ

HMMPanther: PTHR24420
32-335 FAMILY NOT NAMED,FAMILY NOT NAMED

PSPRTEDEILQSPNLKRFCFNELKKATGNFRQRSMVGEGGFGSVFKGWIDHHSLAATKPGSGIAIAVKRHNQEGFQGHNEWLAEINYLGQLHHPNLVKLIGYCLENEDQLLAYEFMSKGSLDNHLFGRGSGSQPLSWKLRMKIALDAAKGLAYLHGKKVIHRDFKSSNILLDANYDAKISDFGLAKDGPVGNESHVSTRCMGTYGYAAPEYMATGHLTPKSDVYSFGAVLLEILCGRRALDATKAGREQNLVEWAKPNISNRRIMRIMDNRIEGECGVKKAITAAKLAFKCLSDDPKHRPSMYQ

superfamily: SSF56112
IPR011009
33-335 Protein kinase-like (PK-like)
Protein kinase-like domain

SPRTEDEILQSPNLKRFCFNELKKATGNFRQRSMVGEGGFGSVFKGWIDHHSLAATKPGSGIAIAVKRHNQEGFQGHNEWLAEINYLGQLHHPNLVKLIGYCLENEDQLLAYEFMSKGSLDNHLFGRGSGSQPLSWKLRMKIALDAAKGLAYLHGKKVIHRDFKSSNILLDANYDAKISDFGLAKDGPVGNESHVSTRCMGTYGYAAPEYMATGHLTPKSDVYSFGAVLLEILCGRRALDATKAGREQNLVEWAKPNISNRRIMRIMDNRIEGECGVKKAITAAKLAFKCLSDDPKHRPSMYQ

Gene3D: G3DSA:3.30.200.20
42-133 no description

QSPNLKRFCFNELKKATGNFRQRSMVGEGGFGSVFKGWIDHHSLAATKPGSGIAIAVKRHNQEGFQGHNEWLAEINYLGQLHHPNLVKLIGY

HMMSmart: SM00219
IPR020635
61-335 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRQRSMVGEGGFGSVFKGWIDHHSLAATKPGSGIAIAVKRHNQEGFQGHNEWLAEINYLGQLHHPNLVKLIGYCLENEDQLLAYEFMSKGSLDNHLFGRGSGSQPLSWKLRMKIALDAAKGLAYLHGKKVIHRDFKSSNILLDANYDAKISDFGLAKDGPVGNESHVSTRCMGTYGYAAPEYMATGHLTPKSDVYSFGAVLLEILCGRRALDATKAGREQNLVEWAKPNISNRRIMRIMDNRIEGECGVKKAITAAKLAFKCLSDDPKHRPSMYQ

HMMSmart: SM00220
IPR002290
61-335 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRQRSMVGEGGFGSVFKGWIDHHSLAATKPGSGIAIAVKRHNQEGFQGHNEWLAEINYLGQLHHPNLVKLIGYCLENEDQLLAYEFMSKGSLDNHLFGRGSGSQPLSWKLRMKIALDAAKGLAYLHGKKVIHRDFKSSNILLDANYDAKISDFGLAKDGPVGNESHVSTRCMGTYGYAAPEYMATGHLTPKSDVYSFGAVLLEILCGRRALDATKAGREQNLVEWAKPNISNRRIMRIMDNRIEGECGVKKAITAAKLAFKCLSDDPKHRPSMYQ

ProfileScan: PS50011
IPR000719
61-335 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRQRSMVGEGGFGSVFKGWIDHHSLAATKPGSGIAIAVKRHNQEGFQGHNEWLAEINYLGQLHHPNLVKLIGYCLENEDQLLAYEFMSKGSLDNHLFGRGSGSQPLSWKLRMKIALDAAKGLAYLHGKKVIHRDFKSSNILLDANYDAKISDFGLAKDGPVGNESHVSTRCMGTYGYAAPEYMATGHLTPKSDVYSFGAVLLEILCGRRALDATKAGREQNLVEWAKPNISNRRIMRIMDNRIEGECGVKKAITAAKLAFKCLSDDPKHRPSMYQ

HMMPfam: PF07714
IPR001245
64-334 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

RSMVGEGGFGSVFKGWIDHHSLAATKPGSGIAIAVKRHNQEGFQGHNEWLAEINYLGQLHHPNLVKLIGYCLENEDQLLAYEFMSKGSLDNHLFGRGSGSQPLSWKLRMKIALDAAKGLAYLHGKKVIHRDFKSSNILLDANYDAKISDFGLAKDGPVGNESHVSTRCMGTYGYAAPEYMATGHLTPKSDVYSFGAVLLEILCGRRALDATKAGREQNLVEWAKPNISNRRIMRIMDNRIEGECGVKKAITAAKLAFKCLSDDPKHRPSMY

PatternScan: PS00107
IPR017441
67-99 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGEGGFGSVFKGWIDHHSLAATKPGSGIAIAVK

Gene3D: G3DSA:1.10.510.10
134-332 no description

CLENEDQLLAYEFMSKGSLDNHLFGRGSGSQPLSWKLRMKIALDAAKGLAYLHGKKVIHRDFKSSNILLDANYDAKISDFGLAKDGPVGNESHVSTRCMGTYGYAAPEYMATGHLTPKSDVYSFGAVLLEILCGRRALDATKAGREQNLVEWAKPNISNRRIMRIMDNRIEGECGVKKAITAAKLAFKCLSDDPKHRPS

PatternScan: PS00108
IPR008271
190-202 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDFKSSNILL

Seg: seg
289-303 seg

NISNRRIMRIMDNRI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox