PRGDB00150871 (Cucsa.011220.1)

From PRG Wiki
Jump to: navigation, search
Cucsa.011220.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGTTATCCAAAGTTCAACACAAGAATCTTGCAAAGTTTATAGGTGCTTGCAAGGAGCCTATTATGGTGATAGTAACTGAGCTTCTTTCAGGCGGAACTTTACGGAAGTACCTGTTGAGTATAAGGCCAAGGTGCTTGGACTTCAGTGAGGCAGTTGGCTTTGCACTTGATATTGCCCGTGCAATGGACTGCTTACATTCCCATGGGATCATTCACCGTGACCTCAAACCTGAGAATTTGATCTTGACTGCAGATCACAAAACTGTTAAACTTGCTGATTTTGGCCTTGCTAGAGAAGAGTCAGTAACAGAGATGATGACAGCTGAAACTGGGACTTACAGATGGATGGCTCCAGAGCTATACAGTACAGTCACTCTACGAAATGGAGAGAAGAAGCATTACAATCACAAGGTGGATGTTTATAGCTTTGGAATTGTATTCTGGGAGATTATCCAAAACAAGTTGCCTTTTGAAGGCATGTCAAATCTACAAGCCGCATATGCGGCTGCTTTTAAGAATTTACGACCGAGTGCCGAGAACCTCCCAGCGGATTTGGCACCAATTGTGACTTCCTGTTGGAAAGAGGATCCGAATGATCGGCCTAACTTCAACCAAATCATACAGATGCTCTTTAAATGTCTATCCACCATTCCACAACCAGAATATGTTCCACCACCAACTATGCACCCACCTGATAATGCAGTGCTGCCACCAGAGTCTCCTGGAACAAGTTCTTTGATGGCAACCACGAGACATGGCACCGGGGAAGTCATGAACAGTGAAATAGGAGAGAAACCGACCGGTTTATTCTCGTGTTTCGCTGGTAACTGTTACTGA


Protein sequences

Name Description Sequence
Cucsa.011220.1 Protein kinase superfamily protein (best arabidopsis hit)

MLSKVQHKNLAKFIGACKEPIMVIVTELLSGGTLRKYLLSIRPRCLDFSEAVGFALDIARAMDCLHSHGIIHRDLKPENLILTADHKTVKLADFGLAREESVTEMMTAETGTYRWMAPELYSTVTLRNGEKKHYNHKVDVYSFGIVFWEIIQNKLPFEGMSNLQAAYAAAFKNLRPSAENLPADLAPIVTSCWKEDPNDRPNFNQIIQMLFKCLSTIPQPEYVPPPTMHPPDNAVLPPESPGTSSLMATTRHGTGEVMNSEIGEKPTGLFSCFAGNCY*

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
1-59 no description

MLSKVQHKNLAKFIGACKEPIMVIVTELLSGGTLRKYLLSIRPRCLDFSEAVGFALDIA

ProfileScan: PS50011
IPR000719
1-212 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MLSKVQHKNLAKFIGACKEPIMVIVTELLSGGTLRKYLLSIRPRCLDFSEAVGFALDIARAMDCLHSHGIIHRDLKPENLILTADHKTVKLADFGLAREESVTEMMTAETGTYRWMAPELYSTVTLRNGEKKHYNHKVDVYSFGIVFWEIIQNKLPFEGMSNLQAAYAAAFKNLRPSAENLPADLAPIVTSCWKEDPNDRPNFNQIIQMLFK

superfamily: SSF56112
IPR011009
1-233 Protein kinase-like (PK-like)
Protein kinase-like domain

MLSKVQHKNLAKFIGACKEPIMVIVTELLSGGTLRKYLLSIRPRCLDFSEAVGFALDIARAMDCLHSHGIIHRDLKPENLILTADHKTVKLADFGLAREESVTEMMTAETGTYRWMAPELYSTVTLRNGEKKHYNHKVDVYSFGIVFWEIIQNKLPFEGMSNLQAAYAAAFKNLRPSAENLPADLAPIVTSCWKEDPNDRPNFNQIIQMLFKCLSTIPQPEYVPPPTMHPPDN

HMMPanther: PTHR23257:SF83
IPR015784
1-248 PROTEIN KINASE ATN1
Serine/threonine-protein kinase, ATN1-like

MLSKVQHKNLAKFIGACKEPIMVIVTELLSGGTLRKYLLSIRPRCLDFSEAVGFALDIARAMDCLHSHGIIHRDLKPENLILTADHKTVKLADFGLAREESVTEMMTAETGTYRWMAPELYSTVTLRNGEKKHYNHKVDVYSFGIVFWEIIQNKLPFEGMSNLQAAYAAAFKNLRPSAENLPADLAPIVTSCWKEDPNDRPNFNQIIQMLFKCLSTIPQPEYVPPPTMHPPDNAVLPPESPGTSSLMA

HMMSmart: SM00220
IPR002290
1-212 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

MLSKVQHKNLAKFIGACKEPIMVIVTELLSGGTLRKYLLSIRPRCLDFSEAVGFALDIARAMDCLHSHGIIHRDLKPENLILTADHKTVKLADFGLAREESVTEMMTAETGTYRWMAPELYSTVTLRNGEKKHYNHKVDVYSFGIVFWEIIQNKLPFEGMSNLQAAYAAAFKNLRPSAENLPADLAPIVTSCWKEDPNDRPNFNQIIQMLFK

HMMPanther: PTHR23257
1-248 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

MLSKVQHKNLAKFIGACKEPIMVIVTELLSGGTLRKYLLSIRPRCLDFSEAVGFALDIARAMDCLHSHGIIHRDLKPENLILTADHKTVKLADFGLAREESVTEMMTAETGTYRWMAPELYSTVTLRNGEKKHYNHKVDVYSFGIVFWEIIQNKLPFEGMSNLQAAYAAAFKNLRPSAENLPADLAPIVTSCWKEDPNDRPNFNQIIQMLFKCLSTIPQPEYVPPPTMHPPDNAVLPPESPGTSSLMA

HMMPfam: PF07714
IPR001245
1-210 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

MLSKVQHKNLAKFIGACKEPIMVIVTELLSGGTLRKYLLSIRPRCLDFSEAVGFALDIARAMDCLHSHGIIHRDLKPENLILTADHKTVKLADFGLAREESVTEMMTAETGTYRWMAPELYSTVTLRNGEKKHYNHKVDVYSFGIVFWEIIQNKLPFEGMSNLQAAYAAAFKNLRPSAENLPADLAPIVTSCWKEDPNDRPNFNQIIQML

HMMSmart: SM00219
IPR020635
1-210 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

MLSKVQHKNLAKFIGACKEPIMVIVTELLSGGTLRKYLLSIRPRCLDFSEAVGFALDIARAMDCLHSHGIIHRDLKPENLILTADHKTVKLADFGLAREESVTEMMTAETGTYRWMAPELYSTVTLRNGEKKHYNHKVDVYSFGIVFWEIIQNKLPFEGMSNLQAAYAAAFKNLRPSAENLPADLAPIVTSCWKEDPNDRPNFNQIIQML

FPrintScan: PR00109
IPR001245
26-39 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

TELLSGGTLRKYLL

Gene3D: G3DSA:1.10.510.10
60-211 no description

RAMDCLHSHGIIHRDLKPENLILTADHKTVKLADFGLAREESVTEMMTAETGTYRWMAPELYSTVTLRNGEKKHYNHKVDVYSFGIVFWEIIQNKLPFEGMSNLQAAYAAAFKNLRPSAENLPADLAPIVTSCWKEDPNDRPNFNQIIQMLF

FPrintScan: PR00109
IPR001245
64-82 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

CLHSHGIIHRDLKPENLIL

PatternScan: PS00108
IPR008271
70-82 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKPENLIL

FPrintScan: PR00109
IPR001245
138-160 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

VDVYSFGIVFWEIIQNKLPFEGM

FPrintScan: PR00109
IPR001245
181-203 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

LPADLAPIVTSCWKEDPNDRPNF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox