PRGDB00150874 (Cucsa.011510.3)

From PRG Wiki
Jump to: navigation, search
Cucsa.011510.3
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGGAGAATCCTTCAGAAAAAAAGTATCCAGTGAATGCCAAGGATTATAACTTACATGAAGAAGTTGGTGAAGGCGTCAGTGCCACTGTGTACAAGGCACTGTGCATTCCGCTAAATGAGATTGTCGCTATAAAGGTTCTTGATTTGGAGAAGTGCAACAATGACCTAGATGGTATTCGGCGAGAGGTTCAAACAATGACTTTGATTGATCATCCAAATTTGTTAAGAGCACATTGTTCCTTCACTGCTGGTCACCACCTTTGGGTTGTGATGCCTTACATGTCAGGAGGATCTTGTCTTCATATTATGAAATCTGCTTATTCGGAAGGTTTTGATGAGCCTGTCATAGCTACCCTATTGCGGGAGGTTCTGAAAGCTCTTGTTTATCTTCATGCTCATGGCCACATCCATAGAGATGTGAAGGCTGGGAATATTTTGCTTGATTCTAATGGTACAGTCAAATTAGCTGATTTTGGAGTCTCAGCTTGCATGTTTGATACTGGAGATAGGCAACGCTCAAGAAACACGTTTGTCGGAACTCCTTGCTGGATGGCACCTGAAGTTATGCAGCAATTACACGGATATGACTTCAAGGCAGACATTTGGTCGTTTGGAATAACAGCACTTGAATTGGCTCATGGGCATGCTCCATTTTCTAAATACCCACCGATGAAAGTTTTGCTAATGACACTACAAAATGCTCCTCCTGGTCTTGACTATGAAAGAGATAAGAGATTTTCTAAGTCGTTCAAAGAAATGGTTGCTACATGCTTAGTGAAGGATCCAAAGAAACGGCCAAGTTCTGAGAAGCTCCTAAAGCACCCTTTTTTTAAACATGCTCGTTCAGTTGATTACCTTACTCGAACAATCCTGGATGGCCTTGATCCATTAGGGGATCGCTTTAAGAAGCTAAAGGCAAAAGAGGCTGATCTTCTGGGACAAAACAAGGCTTTGTATGGGGACAAGGAGCATTTATCACAGCAAGAGTATATTCGAGGAATTAGTGCCTGGAACTTCAACCTTGAGGATTTAAAGAATCAGGCTGCCCTTATTCAAGATGATGATATGTCAAACATAGAAGATCTAGATGTACATACTACACAACAAAGAAACAAGAATAATGAGTTTACCTTTCCGGTAGAGGGTTCATCCCTTGAAAGGCTGAGTCACCCTACTGCTGCAGCTAGTCAGGAGGATGGTTTCAATGATCTTCATGATTTGGAGAGTTCCCTTGCTTCTTTTCCTATGAAACCTCTTGAAGCACTCAAAGATTGTTTTGACATCTATGAAGATATAAGCACAGACAGTGTAAGGCCAGTGGATAGAGAAAATGGAAGAACTGAGGGTGAGAGTTCAGGGCAAAGTGGTTCTTTACCACGTCATTATATGTCAGAGAATAAGAGATCTTTCAGCGGTTCACTAATTTCTGACAATGCTGTATCTCCTAAAAAGATTACTGTAGACGGTGATAGGGACTATTTGCAGTCAAAACTTCCATCTGAGCGCAATTACAGTGGTCCACTATTATATCGCCAGAAAAGGGATACAAATAATGTTTCATCTGTTGAAGATTCATCAGATGGAACAGTTGTTCAGCGCAAGGGGCGGTTTAAAGTTACTTCAGCAGAGCTTAGTCCAAAGGGTCCTATGACGGGCTCATTTAGCCCAGTCTGTGGAGGGACAATAAGTCCAACATCTCTGAACCTCACACCTGCTCTACTCCTCCCATCAATGCAATGCATTTTGCAGCAGAACATCGTTCAACGGGAAGAAATTCTTAAACTGATCAAGTGTTTGGAACAAATGACTGATGCATCAGAGTCGGTCACCAATGATCTTCTGCAGGTACCACCAACTTCCTTGAGGGAAAGAGAGTTGCAATCTCAGGTCGTTCATCTGCAGCAGAGAATTGATCATCTCGTTGAGGAATTAGAGAAGCAAAAATTGAAAAATGTCGAGTTTGAAAGACACGTGATTTCTATGGCAAATAAAGAGAAAACATAA


Protein sequences

Name Description Sequence
Cucsa.011510.3 Protein kinase superfamily protein (best arabidopsis hit)

MENPSEKKYPVNAKDYNLHEEVGEGVSATVYKALCIPLNEIVAIKVLDLEKCNNDLDGIRREVQTMTLIDHPNLLRAHCSFTAGHHLWVVMPYMSGGSCLHIMKSAYSEGFDEPVIATLLREVLKALVYLHAHGHIHRDVKAGNILLDSNGTVKLADFGVSACMFDTGDRQRSRNTFVGTPCWMAPEVMQQLHGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFSKSFKEMVATCLVKDPKKRPSSEKLLKHPFFKHARSVDYLTRTILDGLDPLGDRFKKLKAKEADLLGQNKALYGDKEHLSQQEYIRGISAWNFNLEDLKNQAALIQDDDMSNIEDLDVHTTQQRNKNNEFTFPVEGSSLERLSHPTAAASQEDGFNDLHDLESSLASFPMKPLEALKDCFDIYEDISTDSVRPVDRENGRTEGESSGQSGSLPRHYMSENKRSFSGSLISDNAVSPKKITVDGDRDYLQSKLPSERNYSGPLLYRQKRDTNNVSSVEDSSDGTVVQRKGRFKVTSAELSPKGPMTGSFSPVCGGTISPTSLNLTPALLLPSMQCILQQNIVQREEILKLIKCLEQMTDASESVTNDLLQVPPTSLRERELQSQVVHLQQRIDHLVEELEKQKLKNVEFERHVISMANKEKT*

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
2-308 Protein kinase-like (PK-like)
Protein kinase-like domain

ENPSEKKYPVNAKDYNLHEEVGEGVSATVYKALCIPLNEIVAIKVLDLEKCNNDLDGIRREVQTMTLIDHPNLLRAHCSFTAGHHLWVVMPYMSGGSCLHIMKSAYSEGFDEPVIATLLREVLKALVYLHAHGHIHRDVKAGNILLDSNGTVKLADFGVSACMFDTGDRQRSRNTFVGTPCWMAPEVMQQLHGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFSKSFKEMVATCLVKDPKKRPSSEKLLKHPFFKHARSVDYLTRTILDGLDPLGDRFKKLKAKE

HMMPanther: PTHR24361:SF72
5-665 SUBFAMILY NOT NAMED

SEKKYPVNAKDYNLHEEVGEGVSATVYKALCIPLNEIVAIKVLDLEKCNNDLDGIRREVQTMTLIDHPNLLRAHCSFTAGHHLWVVMPYMSGGSCLHIMKSAYSEGFDEPVIATLLREVLKALVYLHAHGHIHRDVKAGNILLDSNGTVKLADFGVSACMFDTGDRQRSRNTFVGTPCWMAPEVMQQLHGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFSKSFKEMVATCLVKDPKKRPSSEKLLKHPFFKHARSVDYLTRTILDGLDPLGDRFKKLKAKEADLLGQNKALYGDKEHLSQQEYIRGISAWNFNLEDLKNQAALIQDDDMSNIEDLDVHTTQQRNKNNEFTFPVEGSSLERLSHPTAAASQEDGFNDLHDLESSLASFPMKPLEALKDCFDIYEDISTDSVRPVDRENGRTEGESSGQSGSLPRHYMSENKRSFSGSLISDNAVSPKKITVDGDRDYLQSKLPSERNYSGPLLYRQKRDTNNVSSVEDSSDGTVVQRKGRFKVTSAELSPKGPMTGSFSPVCGGTISPTSLNLTPALLLPSMQCILQQNIVQREEILKLIKCLEQMTDASESVTNDLLQVPPTSLRERELQSQVVHLQQRIDHLVEELEKQKLKNVEFERHVISMANKE

HMMPanther: PTHR24361
5-665 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

SEKKYPVNAKDYNLHEEVGEGVSATVYKALCIPLNEIVAIKVLDLEKCNNDLDGIRREVQTMTLIDHPNLLRAHCSFTAGHHLWVVMPYMSGGSCLHIMKSAYSEGFDEPVIATLLREVLKALVYLHAHGHIHRDVKAGNILLDSNGTVKLADFGVSACMFDTGDRQRSRNTFVGTPCWMAPEVMQQLHGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFSKSFKEMVATCLVKDPKKRPSSEKLLKHPFFKHARSVDYLTRTILDGLDPLGDRFKKLKAKEADLLGQNKALYGDKEHLSQQEYIRGISAWNFNLEDLKNQAALIQDDDMSNIEDLDVHTTQQRNKNNEFTFPVEGSSLERLSHPTAAASQEDGFNDLHDLESSLASFPMKPLEALKDCFDIYEDISTDSVRPVDRENGRTEGESSGQSGSLPRHYMSENKRSFSGSLISDNAVSPKKITVDGDRDYLQSKLPSERNYSGPLLYRQKRDTNNVSSVEDSSDGTVVQRKGRFKVTSAELSPKGPMTGSFSPVCGGTISPTSLNLTPALLLPSMQCILQQNIVQREEILKLIKCLEQMTDASESVTNDLLQVPPTSLRERELQSQVVHLQQRIDHLVEELEKQKLKNVEFERHVISMANKE

Gene3D: G3DSA:3.30.200.20
11-93 no description

VNAKDYNLHEEVGEGVSATVYKALCIPLNEIVAIKVLDLEKCNNDLDGIRREVQTMTLIDHPNLLRAHCSFTAGHHLWVVMPY

HMMPfam: PF00069
IPR000719
16-277 Pkinase,Ser-thr
Protein kinase, catalytic domain

YNLHEEVGEGVSATVYKALCIPLNEIVAIKVLDLEKCNNDLDGIRREVQTMTLIDHPNLLRAHCSFTAGHHLWVVMPYMSGGSCLHIMKSAYSEGFDEPVIATLLREVLKALVYLHAHGHIHRDVKAGNILLDSNGTVKLADFGVSACMFDTGDRQRSRNTFVGTPCWMAPEVMQQLHGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFSKSFKEMVATCLVKDPKKRPSSEKLLKHPFF

HMMSmart: SM00220
IPR002290
16-277 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YNLHEEVGEGVSATVYKALCIPLNEIVAIKVLDLEKCNNDLDGIRREVQTMTLIDHPNLLRAHCSFTAGHHLWVVMPYMSGGSCLHIMKSAYSEGFDEPVIATLLREVLKALVYLHAHGHIHRDVKAGNILLDSNGTVKLADFGVSACMFDTGDRQRSRNTFVGTPCWMAPEVMQQLHGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFSKSFKEMVATCLVKDPKKRPSSEKLLKHPFF

HMMSmart: SM00219
IPR020635
16-277 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YNLHEEVGEGVSATVYKALCIPLNEIVAIKVLDLEKCNNDLDGIRREVQTMTLIDHPNLLRAHCSFTAGHHLWVVMPYMSGGSCLHIMKSAYSEGFDEPVIATLLREVLKALVYLHAHGHIHRDVKAGNILLDSNGTVKLADFGVSACMFDTGDRQRSRNTFVGTPCWMAPEVMQQLHGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFSKSFKEMVATCLVKDPKKRPSSEKLLKHPFF

ProfileScan: PS50011
IPR000719
16-277 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YNLHEEVGEGVSATVYKALCIPLNEIVAIKVLDLEKCNNDLDGIRREVQTMTLIDHPNLLRAHCSFTAGHHLWVVMPYMSGGSCLHIMKSAYSEGFDEPVIATLLREVLKALVYLHAHGHIHRDVKAGNILLDSNGTVKLADFGVSACMFDTGDRQRSRNTFVGTPCWMAPEVMQQLHGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFSKSFKEMVATCLVKDPKKRPSSEKLLKHPFF

PatternScan: PS00107
IPR017441
22-45 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGEGVSATVYKALCIPLNEIVAIK

Gene3D: G3DSA:1.10.510.10
94-278 no description

MSGGSCLHIMKSAYSEGFDEPVIATLLREVLKALVYLHAHGHIHRDVKAGNILLDSNGTVKLADFGVSACMFDTGDRQRSRNTFVGTPCWMAPEVMQQLHGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFSKSFKEMVATCLVKDPKKRPSSEKLLKHPFFK

Coil: coil
623-658 coiled-coil

ERELQSQVVHLQQRIDHLVEELEKQKLKNVEFERHV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox