PRGDB00150877 (Cucsa.012030.1)

From PRG Wiki
Jump to: navigation, search
Cucsa.012030.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Pennisetum glaucum

Comment?

transmembrane kinase 1 (best arabidopsis hit)

DNA Sequence

ATGAGGAAACCCCATTTCGGTTTTGGGGTTTTTCTCTTGCTTTTCCCCTTGTTTCTGCACTTTCTGGGGTTCTCTGTTTTTGCTCAGCCGGCCGCCGGTGGTGCTGGTGATGGGTCAGTCATGAATCTCTTGAAGAATAGTGTTGGAGCTCCGAGTTCTCTTGGATGGACTGGTTCGGATTACTGTCAATGGAACCATGTCAAATGTGATTCTCAGAGCCGAGTTGTTAAAATCCAAATTGGGAATCAAAACCTCAAAGGATCACTTCCGAAGGAGCTTTTCAGTCTCTCCGCGTTAGTGCAATTAGAGGTACAGAGCAACCAGTTGGGTGGGCCCTTCCCTAACCTCGCCGATTCTCTTCAGATACTTCTAGCGCATGATAATCTTTTTACTTCCATGCCTGCTGATTTCTTCGCCAAGAAGTCGGCTCTGCAAACCATAGATATCGACAACAATCCCTTCTCGGCGTGGCAGATTCCTGATAATATTCGAGATGCATCTGCGTTACAGCAATTATCGGCCAATCGTGTCAACATCACCGGTATAATCCCTGGAATTTTCGATGGCGCAACGTTTCCGACTCTTACGAACTTGCATTTGGCGGGTAATTTTCTTGAAGGGGAATTACCAGCAAGTCTTGCAGGTTCTTCGATTCAGTCGCTTTGGTTGAATGGACAACAGAGTAGTTCTAAGTTAAACGGTTCAATCGCCATATTGCAAAATATGACTAATCTGCAGGAGGTTTGGTTGCATATGAACCAGTTTTCAGGTCCTTTGCCGGATTTCTCCAATCTTCAGGGATTAGCGAAATTGAGTTTGAGGGATAATCAGCTTACGGGTATTGTTCCTTCATCCTTGGTAAATTTGAAATCTCTCATGGTTGTGAATTTGACCAATAATTTGCTTCAAGGACCAACTCCTGCTTTTGATCCTAATGTTCAGCTGGATATGAAACCACAAACGAACAAGTTTTGCTTGGATTCTCCGGGTGAACCATGTGATCCCCGAGTGAATGCTTTGTTATCAGTTGCAGAGTCCATGGGTTTTCCCACAGCCTTTGCACAAGGCTGGGCAGGGAACGATCCCTGTCAGGGTTTCAAGGGTATTTCATGTATTGGCAACCCTACAAACATAAGTGTAATTAACTTAAAAAATATGGGTCTTGCAGGCTCTATTTCTCCTAGCTTTTCATTGCTTACATCCGTGCAAAAGTTGTTTCTCTCTAACAATTTTCTATCTGGCACAATACCGAATGAACTTGCGACTATGCCTAGTCTTACAGAATTAGATGTCTCCAATAACAGGCTTCATGGGAAAGTTCCAGTCTTCAGGAAGAATGTGATTGTCAACACCCAGGGGAACCCGGATATTGGGAAAGATAATGCCAGTCCTCCCGTACCTGGTTCTCCCACCGGGAGATCGCCCTCTGATGGATCAGGTGACTCAGCTGGTAATGATGAAAAGAAAAGTAATGCTGGAGTGGTTGTTGGCGCTATAATTGGTGTTATTGTTGGCCTTCTTGTTGTTGGGACTGTGATTTTCTTTTTGTGCAAGAGGAAGAAGCGACGTGGTAATAGAGTGCAGAGTCCAAATACTGTGGTGGTACATCCTAGCCATTCTGGAGACCAAAATTCGGTGAAGATTACGATTACAGAGGCTAGATCCGATGGAAGTGCGCCCGAAACCAGCAGAGTTCCTATTGCTGGACCTAGTGACGTGCATGTAGTAGAGGCAGGAAACCTTGTTATCTCGATTCAAGTTTTAAGGAGTGTAACTAATAATTTTAGCCCTGAAAATATATTGGGGAAAGGGGGTTTTGGAACTGTTTACAAGGGAGAATTGCACGATGGTACGATGATTGCTGTGAAGAGAATGGAGTCTGGAGTCATAGGTGAGAAGGGTTTGAATGAATTCAAGGCTGAGATTGCAGTTCTTACAAAGGTTCGCCATAGAAACTTGGTTGCGCTTCTTGGGTATTGCTTGGATGGAAATGAGCGGCTTCTCGTTTATGAATACATGCCCCAGGGGACGTTTAGTAGGTTTCTGTTTAACTGGAAAGAAGAAGGTATTAGACCCCTTGAATGGAAAAGAAGGTTGATTGTTGTCTTGGATGTGGCCAGAGGTGTTGAGTATTTGCATAGTTTAGCACATCAGAGCTTTATCCATCGTGATCTCAAACCATCAAACATTCTTCTCGGAGATGATTTACGGGCTAAAGTAGCTGACTTTGGGTTGGTTCGTCTTGCTCCTGAAGGGAAGGCATCGATTGAAACAAGACTAGCGGGAACATTTGGCTATCTTGCCCCTGAATATGCAGTAACTGGACGAGTTACAACCAAGGTCGATGTTTATAGCTTTGGGGTGATCCTCATGGAGATGATATCTGGTAGAAAAGCAATCGACGAGAGCCAGCCAGAAGAAAGTTTGCACCTTGTATCATGGTTCCGCAGAATGCACATTAACAAGGACACTTTCTCAAAGGCCATAGACCCTTCAATCGACATAGACGAGGAGACCCTTGTCAGCATCAACACAGTTGCAGACTTGGCTGGTCATTGCTGTGCAAGAGAGCCATACCAACGGCCCGACATGGGTCATGCAGTCAACGTGCTTTCGTCTCTAGTCGATGTCTGGAAGCCTACAGAACCAGACTCCGAAGAGAATTTGGGGATTGATCTTGAGCTTTCATTACCACAGGCCCTTAGGAAATGGCAGGCATTTGAAGGAAATAGCAATGTGGACATGTCCTCCTCTTCATCATCATTCCTTGCCAGTGGTGACAATACACAAACCAGCATACCGAACCGGCCATCTGGTTTCGCAAATTCATTTACCTCTGTTGACGCACGGTGA


Protein sequences

Name Description Sequence
Cucsa.012030.1 transmembrane kinase 1 (best arabidopsis hit)

MRKPHFGFGVFLLLFPLFLHFLGFSVFAQPAAGGAGDGSVMNLLKNSVGAPSSLGWTGSDYCQWNHVKCDSQSRVVKIQIGNQNLKGSLPKELFSLSALVQLEVQSNQLGGPFPNLADSLQILLAHDNLFTSMPADFFAKKSALQTIDIDNNPFSAWQIPDNIRDASALQQLSANRVNITGIIPGIFDGATFPTLTNLHLAGNFLEGELPASLAGSSIQSLWLNGQQSSSKLNGSIAILQNMTNLQEVWLHMNQFSGPLPDFSNLQGLAKLSLRDNQLTGIVPSSLVNLKSLMVVNLTNNLLQGPTPAFDPNVQLDMKPQTNKFCLDSPGEPCDPRVNALLSVAESMGFPTAFAQGWAGNDPCQGFKGISCIGNPTNISVINLKNMGLAGSISPSFSLLTSVQKLFLSNNFLSGTIPNELATMPSLTELDVSNNRLHGKVPVFRKNVIVNTQGNPDIGKDNASPPVPGSPTGRSPSDGSGDSAGNDEKKSNAGVVVGAIIGVIVGLLVVGTVIFFLCKRKKRRGNRVQSPNTVVVHPSHSGDQNSVKITITEARSDGSAPETSRVPIAGPSDVHVVEAGNLVISIQVLRSVTNNFSPENILGKGGFGTVYKGELHDGTMIAVKRMESGVIGEKGLNEFKAEIAVLTKVRHRNLVALLGYCLDGNERLLVYEYMPQGTFSRFLFNWKEEGIRPLEWKRRLIVVLDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMEMISGRKAIDESQPEESLHLVSWFRRMHINKDTFSKAIDPSIDIDEETLVSINTVADLAGHCCAREPYQRPDMGHAVNVLSSLVDVWKPTEPDSEENLGIDLELSLPQALRKWQAFEGNSNVDMSSSSSSFLASGDNTQTSIPNRPSGFANSFTSVDAR*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF467
1-935 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MRKPHFGFGVFLLLFPLFLHFLGFSVFAQPAAGGAGDGSVMNLLKNSVGAPSSLGWTGSDYCQWNHVKCDSQSRVVKIQIGNQNLKGSLPKELFSLSALVQLEVQSNQLGGPFPNLADSLQILLAHDNLFTSMPADFFAKKSALQTIDIDNNPFSAWQIPDNIRDASALQQLSANRVNITGIIPGIFDGATFPTLTNLHLAGNFLEGELPASLAGSSIQSLWLNGQQSSSKLNGSIAILQNMTNLQEVWLHMNQFSGPLPDFSNLQGLAKLSLRDNQLTGIVPSSLVNLKSLMVVNLTNNLLQGPTPAFDPNVQLDMKPQTNKFCLDSPGEPCDPRVNALLSVAESMGFPTAFAQGWAGNDPCQGFKGISCIGNPTNISVINLKNMGLAGSISPSFSLLTSVQKLFLSNNFLSGTIPNELATMPSLTELDVSNNRLHGKVPVFRKNVIVNTQGNPDIGKDNASPPVPGSPTGRSPSDGSGDSAGNDEKKSNAGVVVGAIIGVIVGLLVVGTVIFFLCKRKKRRGNRVQSPNTVVVHPSHSGDQNSVKITITEARSDGSAPETSRVPIAGPSDVHVVEAGNLVISIQVLRSVTNNFSPENILGKGGFGTVYKGELHDGTMIAVKRMESGVIGEKGLNEFKAEIAVLTKVRHRNLVALLGYCLDGNERLLVYEYMPQGTFSRFLFNWKEEGIRPLEWKRRLIVVLDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMEMISGRKAIDESQPEESLHLVSWFRRMHINKDTFSKAIDPSIDIDEETLVSINTVADLAGHCCAREPYQRPDMGHAVNVLSSLVDVWKPTEPDSEENLGIDLELSLPQALRKWQAFEGNSNVDMSSSSSSFLASGDNTQTSIPN

HMMPanther: PTHR24420
1-935 FAMILY NOT NAMED,FAMILY NOT NAMED

MRKPHFGFGVFLLLFPLFLHFLGFSVFAQPAAGGAGDGSVMNLLKNSVGAPSSLGWTGSDYCQWNHVKCDSQSRVVKIQIGNQNLKGSLPKELFSLSALVQLEVQSNQLGGPFPNLADSLQILLAHDNLFTSMPADFFAKKSALQTIDIDNNPFSAWQIPDNIRDASALQQLSANRVNITGIIPGIFDGATFPTLTNLHLAGNFLEGELPASLAGSSIQSLWLNGQQSSSKLNGSIAILQNMTNLQEVWLHMNQFSGPLPDFSNLQGLAKLSLRDNQLTGIVPSSLVNLKSLMVVNLTNNLLQGPTPAFDPNVQLDMKPQTNKFCLDSPGEPCDPRVNALLSVAESMGFPTAFAQGWAGNDPCQGFKGISCIGNPTNISVINLKNMGLAGSISPSFSLLTSVQKLFLSNNFLSGTIPNELATMPSLTELDVSNNRLHGKVPVFRKNVIVNTQGNPDIGKDNASPPVPGSPTGRSPSDGSGDSAGNDEKKSNAGVVVGAIIGVIVGLLVVGTVIFFLCKRKKRRGNRVQSPNTVVVHPSHSGDQNSVKITITEARSDGSAPETSRVPIAGPSDVHVVEAGNLVISIQVLRSVTNNFSPENILGKGGFGTVYKGELHDGTMIAVKRMESGVIGEKGLNEFKAEIAVLTKVRHRNLVALLGYCLDGNERLLVYEYMPQGTFSRFLFNWKEEGIRPLEWKRRLIVVLDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMEMISGRKAIDESQPEESLHLVSWFRRMHINKDTFSKAIDPSIDIDEETLVSINTVADLAGHCCAREPYQRPDMGHAVNVLSSLVDVWKPTEPDSEENLGIDLELSLPQALRKWQAFEGNSNVDMSSSSSSFLASGDNTQTSIPN

Seg: seg
4-24 seg

PHFGFGVFLLLFPLFLHFLGF

superfamily: SSF52058
27-317 L domain-like,LRR

FAQPAAGGAGDGSVMNLLKNSVGAPSSLGWTGSDYCQWNHVKCDSQSRVVKIQIGNQNLKGSLPKELFSLSALVQLEVQSNQLGGPFPNLADSLQILLAHDNLFTSMPADFFAKKSALQTIDIDNNPFSAWQIPDNIRDASALQQLSANRVNITGIIPGIFDGATFPTLTNLHLAGNFLEGELPASLAGSSIQSLWLNGQQSSSKLNGSIAILQNMTNLQEVWLHMNQFSGPLPDFSNLQGLAKLSLRDNQLTGIVPSSLVNLKSLMVVNLTNNLLQGPTPAFDPNVQLDM

HMMPfam: PF08263
IPR013210
37-70 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DGSVMNLLKNSVGAPSSLGWTGSDYCQWNHVKCD

Gene3D: G3DSA:3.80.10.10
41-312 no description

MNLLKNSVGAPSSLGWTGSDYCQWNHVKCDSQSRVVKIQIGNQNLKGSLPKELFSLSALVQLEVQSNQLGGPFPNLADSLQILLAHDNLFTSMPADFFAKKSALQTIDIDNNPFSAWQIPDNIRDASALQQLSANRVNITGIIPGIFDGATFPTLTNLHLAGNFLEGELPASLAGSSIQSLWLNGQQSSSKLNGSIAILQNMTNLQEVWLHMNQFSGPLPDFSNLQGLAKLSLRDNQLTGIVPSSLVNLKSLMVVNLTNNLLQGPTPAFDPN

superfamily: SSF52058
330-441 L domain-like,LRR

GEPCDPRVNALLSVAESMGFPTAFAQGWAGNDPCQGFKGISCIGNPTNISVINLKNMGLAGSISPSFSLLTSVQKLFLSNNFLSGTIPNELATMPSLTELDVSNNRLHGKVP

HMMPfam: PF08263
IPR013210
337-371 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

VNALLSVAESMGFPTAFAQGWAGNDPCQGFKGISC

Gene3D: G3DSA:3.80.10.10
339-441 no description

ALLSVAESMGFPTAFAQGWAGNDPCQGFKGISCIGNPTNISVINLKNMGLAGSISPSFSLLTSVQKLFLSNNFLSGTIPNELATMPSLTELDVSNNRLHGKVP

HMMPfam: PF13504
424-437 LRR_7,Leucine rich repeat

PSLTELDVSNNRLH

Seg: seg
492-513 seg

AGVVVGAIIGVIVGLLVVGTVI

superfamily: SSF56112
IPR011009
567-894 Protein kinase-like (PK-like)
Protein kinase-like domain

IAGPSDVHVVEAGNLVISIQVLRSVTNNFSPENILGKGGFGTVYKGELHDGTMIAVKRMESGVIGEKGLNEFKAEIAVLTKVRHRNLVALLGYCLDGNERLLVYEYMPQGTFSRFLFNWKEEGIRPLEWKRRLIVVLDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMEMISGRKAIDESQPEESLHLVSWFRRMHINKDTFSKAIDPSIDIDEETLVSINTVADLAGHCCAREPYQRPDMGHAVNVLSSLVDVWKPTEPDSEENLGIDLE

Gene3D: G3DSA:3.30.200.20
582-658 no description

VISIQVLRSVTNNFSPENILGKGGFGTVYKGELHDGTMIAVKRMESGVIGEKGLNEFKAEIAVLTKVRHRNLVALLG

HMMSmart: SM00219
IPR020635
595-871 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSPENILGKGGFGTVYKGELHDGTMIAVKRMESGVIGEKGLNEFKAEIAVLTKVRHRNLVALLGYCLDGNERLLVYEYMPQGTFSRFLFNWKEEGIRPLEWKRRLIVVLDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMEMISGRKAIDESQPEESLHLVSWFRRMHINKDTFSKAIDPSIDIDEETLVSINTVADLAGHCCAREPYQRPDMGHAVNVL

HMMSmart: SM00220
IPR002290
595-875 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSPENILGKGGFGTVYKGELHDGTMIAVKRMESGVIGEKGLNEFKAEIAVLTKVRHRNLVALLGYCLDGNERLLVYEYMPQGTFSRFLFNWKEEGIRPLEWKRRLIVVLDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMEMISGRKAIDESQPEESLHLVSWFRRMHINKDTFSKAIDPSIDIDEETLVSINTVADLAGHCCAREPYQRPDMGHAVNVLSSLV

ProfileScan: PS50011
IPR000719
595-875 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSPENILGKGGFGTVYKGELHDGTMIAVKRMESGVIGEKGLNEFKAEIAVLTKVRHRNLVALLGYCLDGNERLLVYEYMPQGTFSRFLFNWKEEGIRPLEWKRRLIVVLDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMEMISGRKAIDESQPEESLHLVSWFRRMHINKDTFSKAIDPSIDIDEETLVSINTVADLAGHCCAREPYQRPDMGHAVNVLSSLV

HMMPfam: PF00069
IPR000719
598-869 Pkinase,Ser-thr
Protein kinase, catalytic domain

ENILGKGGFGTVYKGELHDGTMIAVKRMESGVIGEKGLNEFKAEIAVLTKVRHRNLVALLGYCLDGNERLLVYEYMPQGTFSRFLFNWKEEGIRPLEWKRRLIVVLDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMEMISGRKAIDESQPEESLHLVSWFRRMHINKDTFSKAIDPSIDIDEETLVSINTVADLAGHCCAREPYQRPDMGHAVN

PatternScan: PS00107
IPR017441
601-623 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGGFGTVYKGELHDGTMIAVK

Gene3D: G3DSA:1.10.510.10
659-869 no description

YCLDGNERLLVYEYMPQGTFSRFLFNWKEEGIRPLEWKRRLIVVLDVARGVEYLHSLAHQSFIHRDLKPSNILLGDDLRAKVADFGLVRLAPEGKASIETRLAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMEMISGRKAIDESQPEESLHLVSWFRRMHINKDTFSKAIDPSIDIDEETLVSINTVADLAGHCCAREPYQRPDMGHAVN

PatternScan: PS00108
IPR008271
720-732 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FIHRDLKPSNILL

Seg: seg
916-921 seg

SSSSSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox