PRGDB00150878 (Cucsa.012060.1)

From PRG Wiki
Jump to: navigation, search
Cucsa.012060.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pennisetum glaucum

Comment?

lectin protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGTTTTTCGACGCCGCCCCTCTCTCCATCCTCCTCCTCTTACCTCTGGCCTCCGCCCAACCCACAACAAACCCCCGCAAATTCTCCTCCTTCTCAATTTCCCAATCTCCATGGCGGCCCACCCAGAACCTCACTCTCCTTTCCCCCAACTCCCTTTTCGCCGCCGGCTTCCACCCACTACCCAACAACTCCAATCTCTTCATCTTCTCCGTTTGGTACTTCAACATCTCAACCGACAACGTCGTCTGGTCCGCCAACCGTCTTCATCCGGTCAACCGTTCAGCAGCTCTGGTCATCACAGCCACCGGCCAGCTCCGTCTCAACGACGCCTCCGGTCGCAACCTCTGGCCTTCCAACAATGTCTCAGCCCATTCAAACTCGACCCAATTAATCCTTCGCGACGATGGTGACTTGATTTACGGCACATGGGAAAGCTTCCAATTCCCCACCAATACTTTCTTGCCTAATCATACATTTAATGGAACCTCAATCGTCTCCAACAACGGCAAATATTCGTTTGTAAACTCTGCTAATTTGACGTTTGGTACAGAGACTTATTGGTCCTCTGGAAATCCATTCCAGAATTTTCAAATTGATGGTCAAATTATCATAAACAATCAAATCCCAGTTATCCCTTCTGATTTTAACTCGACCCGGTTCCGGAAATTGGTTCTTGATGATGATGGGAACCTCAGGATTTTTAGTTTCAACCCCAATTGGCCTCGGTGGGATGTAGTTTGGCAAGCACATGTAGAGTTGTGTCAAATTTTAGATACTTGTGGCCCAAATTCTGTCTGTATGAGTAGTGGCAGTTACAATTCCACTTATTGTGTCTGCGCACCCGGATTCAGCCCCAATCCTCGAGGAGGAGCGCGGCAGGGATGCCACCGGAAACTCAACGTATCAAACAAACCCAAGTTTCTTCAACTGGATTTTGTGAATTTCAGAGGCGGGGTTAAACAAATCTCTTTGCAAACTCCAAATATTTCAGTCTGTCAAGCGGATTGCTTGAAGAATTCGAGCTGCGTGGGCTATACATTCAGCTTCGACGGCAACGGCAACGCCCACGCCCAGTGTGTGCTTCAGCTAGACATTTTGTCGAACGGGTTGTGGTCTCCTGGGATGAAGGCAGCTGCCTTTGTGAAGGTCGACAATTCGGAAACAGATCGCTCAAATTTCACCGGAATGATGTACAAACTCCAAACTACATGTCCAGTTCGCATAACCCTCCGGCCCCCACCGGTAAATAAAGACAACACCACCAGAAACATATTGATAATCAGTACCATATTCGTTGCCGAACTAATTACCGGTGCAGTTTTCTTCTGGGCATTCTTGAAGAGATTTGTAAAATACAGAGACATGGCTCGCACTCTTGGTCTCGAATCACTTCCCGCCGGCGGCCCAAAGCGGTTCAATTATGCCGAGCTAAAGACGGCCACAAACGACTTCTCGACCTGCATCGGAAGAGGGGGATTCGGCGAAGTCTTCAAGGGGGAGCTGCCAGACAAACGTGTGGTAGCCGTCAAGTGCTTGAAAAACGTCGCGGGAGGTGACCGTGACTTTTGGGCGGAGGTCACCATCATCGCGAGGATGCACCATCTTAACTTGCTTCGATTATGGGGATTCTGCGCAGAAAAGGGTCAGAGAATTTTAGTATACGAACATATCCCGAATGGATCGCTGGACAAATTCCTGTTTGTGAAGCATTCACCTTCCGATTCGGAGAAGGAGGAAAGAGAGACGGAAGAAGAAAGGTCACCGCTGGATTGGAGCATACGGTACCGAATCGCCATCGGAGTAGCGAGAGCAATCGCGTACTTGCACGAGGAATGCTTGGAATGGGTGTTGCATCGAGACATAAAACCAGAGAACATCCTTCTAGACAACGATTTCTGCCCGAAGTTATCAGATTTCGGGTTGTCGAAGTTGAGGAAAAACGAGGAGACAACAGTGAGTATGTCTCGGATCAGAGGGACGCCTGGATATGTAGCACCGGAGCTGGTGAAATTGGGTTCAAATTCAATAACGACGAAGGCAGATGTGTACAGTTTCGGGATGGTGCTGCTGGAGATAATCAGCGGGACAAGGAATTTTGAGATAAAGAGATGGACAGTGGAGAGTGCAGATTGGTACTTTCCAGGATGGGCATTCGAGAAGGCGTTCGTGGAGGAGAAGATGAAGGAGATATTAGACGGTCGGATAAGGGAAGAATACGAGAGGGGGGGTAATGTATGTATTGTTAATCGAATGGTGGAAACGGCGATGTGGTGTCTTCAAAACCAACCGGAGAAGAGACCGTCGATGGGGAAAGTGGTGAAGATGTTGGAAGGGAAGCTTGAAATTCCTCCTCCAGAAAAGCCTTCTATTTACTTCTTGTCTCAATGA


Protein sequences

Name Description Sequence
Cucsa.012060.1 lectin protein kinase family protein (best arabidopsis hit)

MFFDAAPLSILLLLPLASAQPTTNPRKFSSFSISQSPWRPTQNLTLLSPNSLFAAGFHPLPNNSNLFIFSVWYFNISTDNVVWSANRLHPVNRSAALVITATGQLRLNDASGRNLWPSNNVSAHSNSTQLILRDDGDLIYGTWESFQFPTNTFLPNHTFNGTSIVSNNGKYSFVNSANLTFGTETYWSSGNPFQNFQIDGQIIINNQIPVIPSDFNSTRFRKLVLDDDGNLRIFSFNPNWPRWDVVWQAHVELCQILDTCGPNSVCMSSGSYNSTYCVCAPGFSPNPRGGARQGCHRKLNVSNKPKFLQLDFVNFRGGVKQISLQTPNISVCQADCLKNSSCVGYTFSFDGNGNAHAQCVLQLDILSNGLWSPGMKAAAFVKVDNSETDRSNFTGMMYKLQTTCPVRITLRPPPVNKDNTTRNILIISTIFVAELITGAVFFWAFLKRFVKYRDMARTLGLESLPAGGPKRFNYAELKTATNDFSTCIGRGGFGEVFKGELPDKRVVAVKCLKNVAGGDRDFWAEVTIIARMHHLNLLRLWGFCAEKGQRILVYEHIPNGSLDKFLFVKHSPSDSEKEERETEEERSPLDWSIRYRIAIGVARAIAYLHEECLEWVLHRDIKPENILLDNDFCPKLSDFGLSKLRKNEETTVSMSRIRGTPGYVAPELVKLGSNSITTKADVYSFGMVLLEIISGTRNFEIKRWTVESADWYFPGWAFEKAFVEEKMKEILDGRIREEYERGGNVCIVNRMVETAMWCLQNQPEKRPSMGKVVKMLEGKLEIPPPEKPSIYFLSQ*

Domains

Domain Start-End Description Sequence

Seg: seg
5-19 seg

AAPLSILLLLPLASA

HMMPanther: PTHR24420
23-788 FAMILY NOT NAMED,FAMILY NOT NAMED

TNPRKFSSFSISQSPWRPTQNLTLLSPNSLFAAGFHPLPNNSNLFIFSVWYFNISTDNVVWSANRLHPVNRSAALVITATGQLRLNDASGRNLWPSNNVSAHSNSTQLILRDDGDLIYGTWESFQFPTNTFLPNHTFNGTSIVSNNGKYSFVNSANLTFGTETYWSSGNPFQNFQIDGQIIINNQIPVIPSDFNSTRFRKLVLDDDGNLRIFSFNPNWPRWDVVWQAHVELCQILDTCGPNSVCMSSGSYNSTYCVCAPGFSPNPRGGARQGCHRKLNVSNKPKFLQLDFVNFRGGVKQISLQTPNISVCQADCLKNSSCVGYTFSFDGNGNAHAQCVLQLDILSNGLWSPGMKAAAFVKVDNSETDRSNFTGMMYKLQTTCPVRITLRPPPVNKDNTTRNILIISTIFVAELITGAVFFWAFLKRFVKYRDMARTLGLESLPAGGPKRFNYAELKTATNDFSTCIGRGGFGEVFKGELPDKRVVAVKCLKNVAGGDRDFWAEVTIIARMHHLNLLRLWGFCAEKGQRILVYEHIPNGSLDKFLFVKHSPSDSEKEERETEEERSPLDWSIRYRIAIGVARAIAYLHEECLEWVLHRDIKPENILLDNDFCPKLSDFGLSKLRKNEETTVSMSRIRGTPGYVAPELVKLGSNSITTKADVYSFGMVLLEIISGTRNFEIKRWTVESADWYFPGWAFEKAFVEEKMKEILDGRIREEYERGGNVCIVNRMVETAMWCLQNQPEKRPSMGKVVKMLEGKLEIPPPEKP

HMMPanther: PTHR24420:SF576
23-788 OS10G0101000 PROTEIN

TNPRKFSSFSISQSPWRPTQNLTLLSPNSLFAAGFHPLPNNSNLFIFSVWYFNISTDNVVWSANRLHPVNRSAALVITATGQLRLNDASGRNLWPSNNVSAHSNSTQLILRDDGDLIYGTWESFQFPTNTFLPNHTFNGTSIVSNNGKYSFVNSANLTFGTETYWSSGNPFQNFQIDGQIIINNQIPVIPSDFNSTRFRKLVLDDDGNLRIFSFNPNWPRWDVVWQAHVELCQILDTCGPNSVCMSSGSYNSTYCVCAPGFSPNPRGGARQGCHRKLNVSNKPKFLQLDFVNFRGGVKQISLQTPNISVCQADCLKNSSCVGYTFSFDGNGNAHAQCVLQLDILSNGLWSPGMKAAAFVKVDNSETDRSNFTGMMYKLQTTCPVRITLRPPPVNKDNTTRNILIISTIFVAELITGAVFFWAFLKRFVKYRDMARTLGLESLPAGGPKRFNYAELKTATNDFSTCIGRGGFGEVFKGELPDKRVVAVKCLKNVAGGDRDFWAEVTIIARMHHLNLLRLWGFCAEKGQRILVYEHIPNGSLDKFLFVKHSPSDSEKEERETEEERSPLDWSIRYRIAIGVARAIAYLHEECLEWVLHRDIKPENILLDNDFCPKLSDFGLSKLRKNEETTVSMSRIRGTPGYVAPELVKLGSNSITTKADVYSFGMVLLEIISGTRNFEIKRWTVESADWYFPGWAFEKAFVEEKMKEILDGRIREEYERGGNVCIVNRMVETAMWCLQNQPEKRPSMGKVVKMLEGKLEIPPPEKP

ProfileScan: PS50927
IPR001480
37-153 BULB_LECTIN
Bulb-type lectin domain

PWRPTQNLTLLSPNSLFAAGFHPLPNNSNLFIFSVWYFNISTDNVVWSANRLHPVNRSAALVITATGQLRLNDASGRNLWPSNNVSAHSNSTQLILRDDGDLIYGTWESFQFPTNTF

HMMSmart: SM00108
IPR001480
41-149 Bulb-type mannose-specific lectin
Bulb-type lectin domain

TQNLTLLSPNSLFAAGFHPLPNNSNLFIFSVWYFNISTDNVVWSANRLHPVNRSAALVITATGQLRLNDASGRNLWPSNNVSAHSNSTQLILRDDGDLIYGTWESFQFP

superfamily: SSF51110
IPR001480
63-245 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

NSNLFIFSVWYFNISTDNVVWSANRLHPVNRSAALVITATGQLRLNDASGRNLWPSNNVSAHSNSTQLILRDDGDLIYGTWESFQFPTNTFLPNHTFNGTSIVSNNGKYSFVNSANLTFGTETYWSSGNPFQNFQIDGQIIINNQIPVIPSDFNSTRFRKLVLDDDGNLRIFSFNPNWPRWDV

HMMPfam: PF01453
IPR001480
80-168 B_lectin
Bulb-type lectin domain

NVVWSANRLHPVNRSAALVITATGQLRLNDASGRNLWPSNNVSAHSNSTQLILRDDGDLIYGTWESFQFPTNTFLPNHTFNGTSIVSNN

Seg: seg
194-212 seg

QNFQIDGQIIINNQIPVIP

HMMPfam: PF00954
IPR000858
216-286 S_locus_glycop
S-locus glycoprotein

NSTRFRKLVLDDDGNLRIFSFNPNWPRWDVVWQAHVELCQILDTCGPNSVCMSSGSYNSTYCVCAPGFSPN

Gene3D: G3DSA:2.90.10.10
IPR001480
218-241 no description
Bulb-type lectin domain

TRFRKLVLDDDGNLRIFSFNPNWP

ProfileScan: PS50026
IPR000742
250-290 EGF_3
Epidermal growth factor-like domain

HVELCQILDTCGPNSVCMSSGSYNSTYCVCAPGFSPNPRGG

ProfileScan: PS50948
IPR003609
295-385 PAN
Apple-like

CHRKLNVSNKPKFLQLDFVNFRGGVKQISLQTPNISVCQADCLKNSSCVGYTFSFDGNGNAHAQCVLQLDILSNGLWSPGMKAAAFVKVDN

superfamily: SSF56112
IPR011009
454-784 Protein kinase-like (PK-like)
Protein kinase-like domain

DMARTLGLESLPAGGPKRFNYAELKTATNDFSTCIGRGGFGEVFKGELPDKRVVAVKCLKNVAGGDRDFWAEVTIIARMHHLNLLRLWGFCAEKGQRILVYEHIPNGSLDKFLFVKHSPSDSEKEERETEEERSPLDWSIRYRIAIGVARAIAYLHEECLEWVLHRDIKPENILLDNDFCPKLSDFGLSKLRKNEETTVSMSRIRGTPGYVAPELVKLGSNSITTKADVYSFGMVLLEIISGTRNFEIKRWTVESADWYFPGWAFEKAFVEEKMKEILDGRIREEYERGGNVCIVNRMVETAMWCLQNQPEKRPSMGKVVKMLEGKLEIPP

Gene3D: G3DSA:3.30.200.20
467-557 no description

GGPKRFNYAELKTATNDFSTCIGRGGFGEVFKGELPDKRVVAVKCLKNVAGGDRDFWAEVTIIARMHHLNLLRLWGFCAEKGQRILVYEHI

HMMSmart: SM00220
IPR002290
482-776 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

NDFSTCIGRGGFGEVFKGELPDKRVVAVKCLKNVAGGDRDFWAEVTIIARMHHLNLLRLWGFCAEKGQRILVYEHIPNGSLDKFLFVKHSPSDSEKEERETEEERSPLDWSIRYRIAIGVARAIAYLHEECLEWVLHRDIKPENILLDNDFCPKLSDFGLSKLRKNEETTVSMSRIRGTPGYVAPELVKLGSNSITTKADVYSFGMVLLEIISGTRNFEIKRWTVESADWYFPGWAFEKAFVEEKMKEILDGRIREEYERGGNVCIVNRMVETAMWCLQNQPEKRPSMGKVVKML

ProfileScan: PS50011
IPR000719
482-780 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

NDFSTCIGRGGFGEVFKGELPDKRVVAVKCLKNVAGGDRDFWAEVTIIARMHHLNLLRLWGFCAEKGQRILVYEHIPNGSLDKFLFVKHSPSDSEKEERETEEERSPLDWSIRYRIAIGVARAIAYLHEECLEWVLHRDIKPENILLDNDFCPKLSDFGLSKLRKNEETTVSMSRIRGTPGYVAPELVKLGSNSITTKADVYSFGMVLLEIISGTRNFEIKRWTVESADWYFPGWAFEKAFVEEKMKEILDGRIREEYERGGNVCIVNRMVETAMWCLQNQPEKRPSMGKVVKMLEGKL

HMMSmart: SM00219
IPR020635
482-776 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

NDFSTCIGRGGFGEVFKGELPDKRVVAVKCLKNVAGGDRDFWAEVTIIARMHHLNLLRLWGFCAEKGQRILVYEHIPNGSLDKFLFVKHSPSDSEKEERETEEERSPLDWSIRYRIAIGVARAIAYLHEECLEWVLHRDIKPENILLDNDFCPKLSDFGLSKLRKNEETTVSMSRIRGTPGYVAPELVKLGSNSITTKADVYSFGMVLLEIISGTRNFEIKRWTVESADWYFPGWAFEKAFVEEKMKEILDGRIREEYERGGNVCIVNRMVETAMWCLQNQPEKRPSMGKVVKML

HMMPfam: PF00069
IPR000719
486-774 Pkinase,Ser-thr
Protein kinase, catalytic domain

TCIGRGGFGEVFKGELPDKRVVAVKCLKNVAGGDRDFWAEVTIIARMHHLNLLRLWGFCAEKGQRILVYEHIPNGSLDKFLFVKHSPSDSEKEERETEEERSPLDWSIRYRIAIGVARAIAYLHEECLEWVLHRDIKPENILLDNDFCPKLSDFGLSKLRKNEETTVSMSRIRGTPGYVAPELVKLGSNSITTKADVYSFGMVLLEIISGTRNFEIKRWTVESADWYFPGWAFEKAFVEEKMKEILDGRIREEYERGGNVCIVNRMVETAMWCLQNQPEKRPSMGKVVK

PatternScan: PS00107
IPR017441
488-510 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGRGGFGEVFKGELPDKRVVAVK

Seg: seg
576-586 seg

EKEERETEEER

Gene3D: G3DSA:1.10.510.10
577-786 no description

KEERETEEERSPLDWSIRYRIAIGVARAIAYLHEECLEWVLHRDIKPENILLDNDFCPKLSDFGLSKLRKNEETTVSMSRIRGTPGYVAPELVKLGSNSITTKADVYSFGMVLLEIISGTRNFEIKRWTVESADWYFPGWAFEKAFVEEKMKEILDGRIREEYERGGNVCIVNRMVETAMWCLQNQPEKRPSMGKVVKMLEGKLEIPPPE

PatternScan: PS00108
IPR008271
616-628 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDIKPENILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox