PRGDB00160214 (Egrandis_v1_0.048352m)

From PRG Wiki
Jump to: navigation, search
Egrandis_v1_0.048352m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CN
Domain Type NBS
Gene Species Areca catechu

Comment?

pleiotropic drug resistance 12 (best arabidopsis hit)

DNA Sequence

ATGGAAACTGATGATGCATTTAGAATAAGCAGTGCAAGGCTGAGCAGTGCACGTTTGAGCAGCTCGGACATATGGAGGAATAGTGGGAAGGAGATCTTCTCAAGGTCTAGCAGGAATGAGGATGATGAGGAGGCTCTGAAATGGGCTGCAATTGAAAAGCTTCCAACTTACTTGCGCATTCGGCGCACCATTTTTGCCGACAAAGAAGGCAAGATAAGAGAAGTCGATGTCGAGAATCTTGATTTGATGGAGAGGAGGAACTTGTTGGAGAGGTTGCTGAAGACAGCTGAGGAAGACAATGAGAAGTTCTTGTTAAAGCTGAAGCAGAGAATTGAGAGAGTTGGACTGGATTTTCCTACGATTGAAGTCCGATTCGAGCATCTAAATGTCGAGGCTGAAGCTTATGTTGGAAGCCGAGCTCTACCCACAATCTTTAATTTCTCTATCAACATGCTTGAGGGGTTTCTCAACTATTTTCACATCCTTCCTAGTAGAAAGAAGCCATTACCAATCCTCAATGATGTCAGCGGAATCATTAAGCCTCGCAGAATGACATTACTTCTGGGGCCTCCAGGCTCTGGAAAGACAACGTTGCTTCTAGCATTAGCAGGGAAGCTTGGCAGAGATTTGACTCTTTCAGGAAGAGTCACGTACAATGGACAAGGGATGGAAGAATTTGTACCGCAGAGGACATCAGCTTATATAAGTCAATATGATCTCCATATAGCAGAAATGACTATTAGGGAAACTTTGGCTTTCTCAGCCAGGTGTCAAGGTGTCGGACCCCATTATGATATGCTAGCAGAGTTATTAAGGAGAGAGAAGGAGGCAAACATCACACCTGATCCTGATATAGATATCTTTATGAAGGCAGCAGCACTGGAAGGACAGGAGACTAATGTTGTCGTCGATTATATAATCAAGATACTAGGACTTGAAATCTGTGCCGACACAATAGTGGGAGATGAAATGATACGAGGCATCTCTGGGGGACAAAAGAAACGAGTCACAACAGGGGAGATGCTAGTCGGACCAGCCAAAGCACTCTTTATGGATGAAATATCAACTGGTTTGGATTGTTCGACAACATTCCAAATAGTGAAATCACTCAGACAGTCCATACACATCCTCAATGGGACTGCTCTAGTATCCCTCCTCCAGCCTGCGCCGGAAACTTATGACCTGTTTGACGATATCATCCTTGTCTCGGAGGGGCAAATTGTTTACCAAGGTCCCCGAGAAAACGTGCTCGAGTTTTTCAGACACATGGGTTTTAAATGTCCTGAAAGGAAAGGAGTAGCTGATTTCTTGCAAGAAGTGACTTCAAGGAAAGATCAAGAGCAGTATTGGGCGAATAAGGACACACCTTATAGGTTTGTAACAGTCAAGGAATTTTCCGAAGCGTTTCAGTCATTCCCCATTGGTCAGAAACTAGGTGATCAGCTTGTGATCCCATTCGACAAGTCAAAAGGCCTTCCAGCTGCTTTAACAACTAAGAAGTATGGGGTGAGCCAGAAAGAACTGTTGAGAGCTTGCATTTCAAGGGAAATTTTGCTAATGAAGAGAAATTCGTTTGTCTATTTTTTCAAAATGTTCCAGCTTACCCTTATGGCTTTCATAACAATGACGGTGTTCCTACGGACTGAGATGCACCGAGATACCGTGATAGATGGTGGGATTTATTTTGGCGCTCTCTTCTTCACTGTGATCATTATAATGCTTAATGGATTCTCAGAGCTTGCCATGACCATCATGAAGCTCCCAGTCTTCTACAAGCAGAGAGACCTCCTCTTCTTTCCTGTGTGGGCATATTCGCTGCCCACATGGATCCTGAAGATTCCAGTCACCATAGTAGAAGTTGCTATTTGGGTGATCATGACTTACTATGTCATAGGCTACGACCCTTACGCTGGAAGGTTCTTCAAACAGTATTTTCTGCTACTATGTCTACATCAGATGGCATCTGGATTATTTCGACTCATTGCGGCATTGGGAAGGAATGTGATAGTGGCAAATACTTTTGGATCATTTGGATTACTTGCTTTTATGGTCTTGGGCGGATTCATCATATCAAGAGATGATATTAAGCCGTGGTGGATATGGGGTTATTGGATCTCCCCAATGATGTATGGACAGAACGCAATCTCTGTAAACGAATTTCTCGGAAAGCAGTGGAGACATATTCCTCCTAATTCCACAGAACCTTTAGGAGTTTTGGTCCTGAAATCCCGCGGAATTTTTCCTGAAGCACGTTGGTATTGGATAGGAGTAGGAGCATCGATTGGATACATTTTTCTGTTCAATTTCTTGTTCACTGTGGCCTTGAAATATCTTGACCCAATTGGGAAGCCCCAAGCTGTACTATCCAAAGAGACTCTGGCAGAGAAAATCGCAAGCAAGAATGGTGAGGTTATTGAGCTATCGTCAAGGAGCCAGAGGAGTTCATCTGTTGAAGGAATAAAGGATTCGGACCTGAATAGGAAACGGGGAATGGTTCTTCCTTTTGAGCCACTTTCTATTGCTTTTGATGATATCAGATACGCCATAGACATGCCCCGGGAAATGAAAGCTCAAGGTATTCCTGAAGATCGGCTGGAACTTCTAAAAGGTGTAAGTGGTGCTTTCAGGACAGGAGTATTGACAGCTTTAATGGGTGTCAGTGGTGCTGGAAAGACCACTCTAATGGACGTGTTGGCTGGAAGGAAAACAGGTGGATACATCAACGGGACAATCACGATATCTGGGTACCCAAAGAAGCAAGAAACATTTGCTCGCATATCAGGATACTGTGAACAAACCGATATCCACTCTCCTCACGTCACAGTTTACGAGTCATTGGTGTATTCTGCATGGCTTCGGTTACCTCCTGAAGTGGATTCTAAGACTAGGAAGATGTTCATTGAAGACGTCATGGAGCTCATAGAGCTTACCCCGTTACGAGAAGCGCTAGTTGGGTTGACTGGTGTGAATGGCCTCTCCACCGAGCAAAGGAAAAGGCTGACAATTGCAGTGGAGCTTGTAGCCAACCCGTCAATCATATTCATGGATGAGCCTACCTCTGGCCTTGATGCCAGGGCAGCTGCTATAGTAATGAGAACAGTTAGAAACACAGTTGACACAGGGCGAACTGTTGTTTGCACCATCCACCAGCCGAGCATTGACATATTTGATGCTTTTGATGAGCTGTTTCTTCTGAAAAAAGGGGGAGAGGAGATCTATGTCGGTCCAACAGGCCAGCATTCCTTGCATCTGATCAACTACTTTGAGGGCATCAATGGAGTTCCGAAAATTAAAGACGGATACAATCCAGCAACTTGGATGTTGGAGGTGACAACAGCTGCTCAAGAAGAAATCCTTGGGGTTAACTTAACCGAAGTGTACAGGAGTTCAGATCTGTTTAGGAGAAACAAAGCTCTGATCAACGAACTGAGTACGCCTCCACCGGGGTCAAAAGATCTCCATTTCCCAACGCAATATTCACAATCATTCTTCACCCAGTGTATGGCTTGCCTGTGGAAACAACACTGGTCGTATGAGCGCAACACGGCATACACAGCTGTGAGACTTCTATTCACAACTTTCATAGCCCTGATGTTCGGCACGATATTTTGGAACCTCGGCTCTAAAAGGAGAAACCAGCAAGATCTCTTCAATGCCATGGGCTCAATGTACTCGGCTGTCATTTTCATTGGATTTCAAAATACAAAGTCAGTTCAACCCGTTGTGGCTATTGAGAGGACCGTCTTCTATAGAGAGAGAGCGGCTGGAATGTATTCCGCTCTGCCCTATGCCTTCGCACATGTTATCATCGAGATTCCCTACATCTTCATCCAAACTGTCATCTATGGAGTGATCGTCTATGCAATGATTGGGTTCGAATGGACAGCCAGCAAGTTCTTTTGGTACATCTTCTGTATGTTCTTCACCTTGTTATTCTTCACTCTCTATGGAATGATGAGCGTGGCAGTGACGCCCAACCACAACATAGCCACCATAATCGCTTCGGCATTCTTTGCAATTTGGAACCTTTTCTCGGGATTCATCGTGCCGCACACAAGAATACCTGTCTGGTGGAGGTGGTACTCCTGGACATGTCCAATTTTTTGGACATTGTACGGACTGGTGGCCTCGCAGTTTGGAGATGTTAAGGACGTGCTTGACAGTGGCGAGACAGTCGAAGAGTTTGTGAGGAGTTATTTTGGGTTCAGACATGACTTCTTGGGAGTGGTCGCGATCGTGCTGGTCGGATTGTCTCTCCTCTCTGGATTCATCTTCGCCTTCTCAACCAAAGCATTCAACTTCCAAAAGAGATGA


Protein sequences

Name Description Sequence
Egrandis_v1_0.048352m pleiotropic drug resistance 12 (best arabidopsis hit)

METDDAFRISSARLSSARLSSSDIWRNSGKEIFSRSSRNEDDEEALKWAAIEKLPTYLRIRRTIFADKEGKIREVDVENLDLMERRNLLERLLKTAEEDNEKFLLKLKQRIERVGLDFPTIEVRFEHLNVEAEAYVGSRALPTIFNFSINMLEGFLNYFHILPSRKKPLPILNDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGKLGRDLTLSGRVTYNGQGMEEFVPQRTSAYISQYDLHIAEMTIRETLAFSARCQGVGPHYDMLAELLRREKEANITPDPDIDIFMKAAALEGQETNVVVDYIIKILGLEICADTIVGDEMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDCSTTFQIVKSLRQSIHILNGTALVSLLQPAPETYDLFDDIILVSEGQIVYQGPRENVLEFFRHMGFKCPERKGVADFLQEVTSRKDQEQYWANKDTPYRFVTVKEFSEAFQSFPIGQKLGDQLVIPFDKSKGLPAALTTKKYGVSQKELLRACISREILLMKRNSFVYFFKMFQLTLMAFITMTVFLRTEMHRDTVIDGGIYFGALFFTVIIIMLNGFSELAMTIMKLPVFYKQRDLLFFPVWAYSLPTWILKIPVTIVEVAIWVIMTYYVIGYDPYAGRFFKQYFLLLCLHQMASGLFRLIAALGRNVIVANTFGSFGLLAFMVLGGFIISRDDIKPWWIWGYWISPMMYGQNAISVNEFLGKQWRHIPPNSTEPLGVLVLKSRGIFPEARWYWIGVGASIGYIFLFNFLFTVALKYLDPIGKPQAVLSKETLAEKIASKNGEVIELSSRSQRSSSVEGIKDSDLNRKRGMVLPFEPLSIAFDDIRYAIDMPREMKAQGIPEDRLELLKGVSGAFRTGVLTALMGVSGAGKTTLMDVLAGRKTGGYINGTITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSKTRKMFIEDVMELIELTPLREALVGLTGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKKGGEEIYVGPTGQHSLHLINYFEGINGVPKIKDGYNPATWMLEVTTAAQEEILGVNLTEVYRSSDLFRRNKALINELSTPPPGSKDLHFPTQYSQSFFTQCMACLWKQHWSYERNTAYTAVRLLFTTFIALMFGTIFWNLGSKRRNQQDLFNAMGSMYSAVIFIGFQNTKSVQPVVAIERTVFYRERAAGMYSALPYAFAHVIIEIPYIFIQTVIYGVIVYAMIGFEWTASKFFWYIFCMFFTLLFFTLYGMMSVAVTPNHNIATIIASAFFAIWNLFSGFIVPHTRIPVWWRWYSWTCPIFWTLYGLVASQFGDVKDVLDSGETVEEFVRSYFGFRHDFLGVVAIVLVGLSLLSGFIFAFSTKAFNFQKR*

Domains

Domain Start-End Description Sequence

Seg: seg
10-22 seg

SSARLSSARLSSS

Seg: seg
78-93 seg

ENLDLMERRNLLERLL

Coil: coil
79-107 coiled-coil

NLDLMERRNLLERLLKTAEEDNEKFLLKL

ProfileScan: PS50893
IPR003439
156-429 ABC_TRANSPORTER_2
ABC transporter-like

LNYFHILPSRKKPLPILNDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGKLGRDLTLSGRVTYNGQGMEEFVPQRTSAYISQYDLHIAEMTIRETLAFSARCQGVGPHYDMLAELLRREKEANITPDPDIDIFMKAAALEGQETNVVVDYIIKILGLEICADTIVGDEMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDCSTTFQIVKSLRQSIHILNGTALVSLLQPAPETYDLFDDIILVSEGQIVYQGPRENVLEFFRHMGFKCPE

superfamily: SSF52540
169-433 P-loop containing nucleoside triphosphate hydrolases

LPILNDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGKLGRDLTLSGRVTYNGQGMEEFVPQRTSAYISQYDLHIAEMTIRETLAFSARCQGVGPHYDMLAELLRREKEANITPDPDIDIFMKAAALEGQETNVVVDYIIKILGLEICADTIVGDEMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDCSTTFQIVKSLRQSIHILNGTALVSLLQPAPETYDLFDDIILVSEGQIVYQGPRENVLEFFRHMGFKCPERKGV

Gene3D: G3DSA:3.40.50.300
169-418 no description

LPILNDVSGIIKPRRMTLLLGPPGSGKTTLLLALAGKLGRDLTLSGRVTYNGQGMEEFVPQRTSAYISQYDLHIAEMTIRETLAFSARCQGVGPHYDMLAELLRREKEANITPDPDIDIFMKAAALEGQETNVVVDYIIKILGLEICADTIVGDEMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDCSTTFQIVKSLRQSIHILNGTALVSLLQPAPETYDLFDDIILVSEGQIVYQGPRENVLE

HMMSmart: SM00382
IPR003593
181-406 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PRRMTLLLGPPGSGKTTLLLALAGKLGRDLTLSGRVTYNGQGMEEFVPQRTSAYISQYDLHIAEMTIRETLAFSARCQGVGPHYDMLAELLRREKEANITPDPDIDIFMKAAALEGQETNVVVDYIIKILGLEICADTIVGDEMIRGISGGQKKRVTTGEMLVGPAKALFMDEISTGLDCSTTFQIVKSLRQSIHILNGTALVSLLQPAPETYDLFDDIILVSEGQ

Seg: seg
194-207 seg

GKTTLLLALAGKLG

HMMPfam: PF00005
IPR003439
196-353 ABC_tran
ABC transporter-like

TTLLLALAGKLGRDLTLSGRVTYNGQGMEEFVPQRTSAYISQYDLHIAEMTIRETLAFSARCQGVGPHYDMLAELLRREKEANITPDPDIDIFMKAAALEGQETNVVVDYIIKILGLEICADTIVGDEMIRGISGGQKKRVTTGEMLVGPAKALFMDE

HMMPanther: PTHR19241
357-1437 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

GLDCSTTFQIVKSLRQSIHILNGTALVSLLQPAPETYDLFDDIILVSEGQIVYQGPRENVLEFFRHMGFKCPERKGVADFLQEVTSRKDQEQYWANKDTPYRFVTVKEFSEAFQSFPIGQKLGDQLVIPFDKSKGLPAALTTKKYGVSQKELLRACISREILLMKRNSFVYFFKMFQLTLMAFITMTVFLRTEMHRDTVIDGGIYFGALFFTVIIIMLNGFSELAMTIMKLPVFYKQRDLLFFPVWAYSLPTWILKIPVTIVEVAIWVIMTYYVIGYDPYAGRFFKQYFLLLCLHQMASGLFRLIAALGRNVIVANTFGSFGLLAFMVLGGFIISRDDIKPWWIWGYWISPMMYGQNAISVNEFLGKQWRHIPPNSTEPLGVLVLKSRGIFPEARWYWIGVGASIGYIFLFNFLFTVALKYLDPIGKPQAVLSKETLAEKIASKNGEVIELSSRSQRSSSVEGIKDSDLNRKRGMVLPFEPLSIAFDDIRYAIDMPREMKAQGIPEDRLELLKGVSGAFRTGVLTALMGVSGAGKTTLMDVLAGRKTGGYINGTITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSKTRKMFIEDVMELIELTPLREALVGLTGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKKGGEEIYVGPTGQHSLHLINYFEGINGVPKIKDGYNPATWMLEVTTAAQEEILGVNLTEVYRSSDLFRRNKALINELSTPPPGSKDLHFPTQYSQSFFTQCMACLWKQHWSYERNTAYTAVRLLFTTFIALMFGTIFWNLGSKRRNQQDLFNAMGSMYSAVIFIGFQNTKSVQPVVAIERTVFYRERAAGMYSALPYAFAHVIIEIPYIFIQTVIYGVIVYAMIGFEWTASKFFWYIFCMFFTLLFFTLYGMMSVAVTPNHNIATIIASAFFAIWNLFSGFIVPHTRIPVWWRWYSWTCPIFWTLYGLVASQFGDVKDVLDSGETVEEFVRSYFGFRHDFLGVVAIVLVGLSLLSGFIFAFSTKAFNFQKR

HMMPanther: PTHR19241:SF10
357-1437 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

GLDCSTTFQIVKSLRQSIHILNGTALVSLLQPAPETYDLFDDIILVSEGQIVYQGPRENVLEFFRHMGFKCPERKGVADFLQEVTSRKDQEQYWANKDTPYRFVTVKEFSEAFQSFPIGQKLGDQLVIPFDKSKGLPAALTTKKYGVSQKELLRACISREILLMKRNSFVYFFKMFQLTLMAFITMTVFLRTEMHRDTVIDGGIYFGALFFTVIIIMLNGFSELAMTIMKLPVFYKQRDLLFFPVWAYSLPTWILKIPVTIVEVAIWVIMTYYVIGYDPYAGRFFKQYFLLLCLHQMASGLFRLIAALGRNVIVANTFGSFGLLAFMVLGGFIISRDDIKPWWIWGYWISPMMYGQNAISVNEFLGKQWRHIPPNSTEPLGVLVLKSRGIFPEARWYWIGVGASIGYIFLFNFLFTVALKYLDPIGKPQAVLSKETLAEKIASKNGEVIELSSRSQRSSSVEGIKDSDLNRKRGMVLPFEPLSIAFDDIRYAIDMPREMKAQGIPEDRLELLKGVSGAFRTGVLTALMGVSGAGKTTLMDVLAGRKTGGYINGTITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSKTRKMFIEDVMELIELTPLREALVGLTGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKKGGEEIYVGPTGQHSLHLINYFEGINGVPKIKDGYNPATWMLEVTTAAQEEILGVNLTEVYRSSDLFRRNKALINELSTPPPGSKDLHFPTQYSQSFFTQCMACLWKQHWSYERNTAYTAVRLLFTTFIALMFGTIFWNLGSKRRNQQDLFNAMGSMYSAVIFIGFQNTKSVQPVVAIERTVFYRERAAGMYSALPYAFAHVIIEIPYIFIQTVIYGVIVYAMIGFEWTASKFFWYIFCMFFTLLFFTLYGMMSVAVTPNHNIATIIASAFFAIWNLFSGFIVPHTRIPVWWRWYSWTCPIFWTLYGLVASQFGDVKDVLDSGETVEEFVRSYFGFRHDFLGVVAIVLVGLSLLSGFIFAFSTKAFNFQKR

HMMPfam: PF01061
IPR013525
508-720 ABC2_membrane
ABC-2 type transporter

LLRACISREILLMKRNSFVYFFKMFQLTLMAFITMTVFLRTEMHRDTVIDGGIYFGALFFTVIIIMLNGFSELAMTIMKLPVFYKQRDLLFFPVWAYSLPTWILKIPVTIVEVAIWVIMTYYVIGYDPYAGRFFKQYFLLLCLHQMASGLFRLIAALGRNVIVANTFGSFGLLAFMVLGGFIISRDDIKPWWIWGYWISPMMYGQNAISVNEF

HMMPfam: PF08370
IPR013581
725-789 PDR_assoc
Plant PDR ABC transporter associated

WRHIPPNSTEPLGVLVLKSRGIFPEARWYWIGVGASIGYIFLFNFLFTVALKYLDPIGKPQAVLS

Seg: seg
808-816 seg

SSRSQRSSS

ProfileScan: PS50893
IPR003439
840-1092 ABC_TRANSPORTER_2
ABC transporter-like

IAFDDIRYAIDMPREMKAQGIPEDRLELLKGVSGAFRTGVLTALMGVSGAGKTTLMDVLAGRKTGGYINGTITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSKTRKMFIEDVMELIELTPLREALVGLTGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKKGGEEIYVGPTGQHSLHLINYFEGIN

Gene3D: G3DSA:3.40.50.300
863-1076 no description

DRLELLKGVSGAFRTGVLTALMGVSGAGKTTLMDVLAGRKTGGYINGTITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSKTRKMFIEDVMELIELTPLREALVGLTGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKKGGEEIYVGP

superfamily: SSF52540
867-1079 P-loop containing nucleoside triphosphate hydrolases

LLKGVSGAFRTGVLTALMGVSGAGKTTLMDVLAGRKTGGYINGTITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSKTRKMFIEDVMELIELTPLREALVGLTGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKKGGEEIYVGPTGQ

HMMSmart: SM00382
IPR003593
877-1069 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

TGVLTALMGVSGAGKTTLMDVLAGRKTGGYINGTITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSKTRKMFIEDVMELIELTPLREALVGLTGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFDAFDELFLLKKGG

HMMPfam: PF00005
IPR003439
892-1020 ABC_tran
ABC transporter-like

TTLMDVLAGRKTGGYINGTITISGYPKKQETFARISGYCEQTDIHSPHVTVYESLVYSAWLRLPPEVDSKTRKMFIEDVMELIELTPLREALVGLTGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTS

HMMPfam: PF01061
IPR013525
1165-1379 ABC2_membrane
ABC-2 type transporter

TQCMACLWKQHWSYERNTAYTAVRLLFTTFIALMFGTIFWNLGSKRRNQQDLFNAMGSMYSAVIFIGFQNTKSVQPVVAIERTVFYRERAAGMYSALPYAFAHVIIEIPYIFIQTVIYGVIVYAMIGFEWTASKFFWYIFCMFFTLLFFTLYGMMSVAVTPNHNIATIIASAFFAIWNLFSGFIVPHTRIPVWWRWYSWTCPIFWTLYGLVASQF

Seg: seg
1307-1315 seg

FFTLLFFTL

Seg: seg
1329-1340 seg

IATIIASAFFAI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox