PRGDB00160219 (Egrandis_v1_0.030102m)

From PRG Wiki
Jump to: navigation, search
Egrandis_v1_0.030102m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class T
Domain Type TIR, LRR
Gene Species Areca catechu

Comment?

disease resistance protein (TIR-NBS-LRR class) (best arabidopsis hit)

DNA Sequence

ATGTTCACTGATCATCTCTATAAAAGGCTTGTCAAGGCAAAAATTTGTGTGTTCAGAGACGACGATAAGCTCCCTGTTGGTGAGGAGATTGGTCCAGAACTTCTTTGCAGCATTAGGCAGTCCAAAATTTCGATTCCGATTATCTCCACGAACTATGCTTTCAGCAAATGGTGCCTTCGGGAGCTAGCTTGGATGTTGAAGTGTAAGAGAAGCGGAGGGCATTTAGTGTTGCCCATCTTTTACAACGTGAATCCCTCGCATGTGCGCCATCTTACAGGAAGATTTAGAAAGGGTATCGAGGCACATAAAGACAGTATAGATGAAAAGGTTTTGAAGGAATGGAAAAAAGCGCTCAAAGAATTGAAGGAATGGGAAGAAGCACTCCAAGAAGTTGGTTCTTTGAAAGGATGGGAATCTAAGAAAAATGAAAACGGGTACATTATTCTCAACCAAATCGTTGTTTAA


Protein sequences

Name Description Sequence
Egrandis_v1_0.030102m disease resistance protein (TIR-NBS-LRR class) (best arabidopsis hit)

MFTDHLYKRLVKAKICVFRDDDKLPVGEEIGPELLCSIRQSKISIPIISTNYAFSKWCLRELAWMLKCKRSGGHLVLPIFYNVNPSHVRHLTGRFRKGIEAHKDSIDEKVLKEWKKALKELKEWEEALQEVGSLKGWESKKNENGYIILNQIVV*

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
1-134 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MFTDHLYKRLVKAKICVFRDDDKLPVGEEIGPELLCSIRQSKISIPIISTNYAFSKWCLRELAWMLKCKRSGGHLVLPIFYNVNPSHVRHLTGRFRKGIEAHKDSIDEKVLKEWKKALKELKEWEEALQEVGSL

superfamily: SSF52200
IPR000157
1-127 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

MFTDHLYKRLVKAKICVFRDDDKLPVGEEIGPELLCSIRQSKISIPIISTNYAFSKWCLRELAWMLKCKRSGGHLVLPIFYNVNPSHVRHLTGRFRKGIEAHKDSIDEKVLKEWKKALKELKEWEEA

HMMSmart: SM00255
IPR000157
2-134 Toll
Toll/interleukin-1 receptor homology (TIR) domain

FTDHLYKRLVKAKICVFRDDDKLPVGEEIGPELLCSIRQSKISIPIISTNYAFSKWCLRELAWMLKCKRSGGHLVLPIFYNVNPSHVRHLTGRFRKGIEAHKDSIDEKVLKEWKKALKELKEWEEALQEVGSL

Gene3D: G3DSA:3.40.50.10140
2-122 no description

FTDHLYKRLVKAKICVFRDDDKLPVGEEIGPELLCSIRQSKISIPIISTNYAFSKWCLRELAWMLKCKRSGGHLVLPIFYNVNPSHVRHLTGRFRKGIEAHKDSIDEKVLKEWKKALKELK

HMMPfam: PF01582
IPR000157
2-119 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FTDHLYKRLVKAKICVFRDDDKLPVGEEIGPELLCSIRQSKISIPIISTNYAFSKWCLRELAWMLKCKRSGGHLVLPIFYNVNPSHVRHLTGRFRKGIEAHKDSIDEKVLKEWKKALK

Seg: seg
108-128 seg

EKVLKEWKKALKELKEWEEAL

Coil: coil
111-132 coiled-coil

LKEWKKALKELKEWEEALQEVG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox