PRGDB00160292 (Egrandis_v1_0.054406m)

From PRG Wiki
Jump to: navigation, search
Egrandis_v1_0.054406m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class T
Domain Type TIR, LRR
Gene Species Areca catechu

Comment?

toll/interleukin-1 receptor-like (best arabidopsis hit)

DNA Sequence

ATGCCAAGAAGGAGCACTTATGCAGATCATTCCCGAGATCCCCGAGCTGACGAAGAAGAAGAAGAAGATTACTATGAAGTGTTCCTGAGCTTTTGTGGGGGAGACACTCGTACTGGCCTGACTGACAACCTTTACAGGAAACTGGTTGAAGCGGGAGTCTATGTCTACAGAGACAACAACGAGCTCCATATAGGTGAGGTGTTCGGCCCGGAGCTTCTCAATGCGATTCCGCGATCTGGGATATTGATCCCAATCCTCTCGGAAAACTACGGCTCAAGAGAATGGTGCCTCCACGAGCTCACACAAATGATGGAGTGCAAGAGAAACAATGGAAGGTATATGGTGGTGCCTGTATTTTACAAGGTGAAGCCAGCACACGTGCGGCACCAGACTGGGATTTTCGGGGAGAGGTTCCAATCCGGTACAAGGCGATTCAATGAACAAGTTGTGGAGGAATGGAAGCATGCGCTTGGAGAAGTCAGTTCCATACTAGGATATGAATATGAGGAAGGGCAGGAAACAGAGATGATCGAGAAGGTCGTTGAGCAGGTTTGTTGCGAGTTAGAGGAAGCCCATCATCTCACCTATTCCATGGAAGCGGAGGTGATAGCAAGACTGAAAGAGGATTATCACTGTGAGTTGACACGCCTCGTGGAAGAAAATCGTGGGGCGGAGGAAAGGGAAATGTTACATCGCGATTTTCAGGATAGTCAGAGGAGGACACCGGTGCCGAGGAGCATGCGGAGCGATGGGAAAATG


Protein sequences

Name Description Sequence
Egrandis_v1_0.054406m toll/interleukin-1 receptor-like (best arabidopsis hit)

MPRRSTYADHSRDPRADEEEEEDYYEVFLSFCGGDTRTGLTDNLYRKLVEAGVYVYRDNNELHIGEVFGPELLNAIPRSGILIPILSENYGSREWCLHELTQMMECKRNNGRYMVVPVFYKVKPAHVRHQTGIFGERFQSGTRRFNEQVVEEWKHALGEVSSILGYEYEEGQETEMIEKVVEQVCCELEEAHHLTYSMEAEVIARLKEDYHCELTRLVEENRGAEEREMLHRDFQDSQRRTPVPRSMRSDGKM

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
13-166 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

DPRADEEEEEDYYEVFLSFCGGDTRTGLTDNLYRKLVEAGVYVYRDNNELHIGEVFGPELLNAIPRSGILIPILSENYGSREWCLHELTQMMECKRNNGRYMVVPVFYKVKPAHVRHQTGIFGERFQSGTRRFNEQVVEEWKHALGEVSSILGY

Seg: seg
17-26 seg

DEEEEEDYYE

Gene3D: G3DSA:3.40.50.10140
22-160 no description

EDYYEVFLSFCGGDTRTGLTDNLYRKLVEAGVYVYRDNNELHIGEVFGPELLNAIPRSGILIPILSENYGSREWCLHELTQMMECKRNNGRYMVVPVFYKVKPAHVRHQTGIFGERFQSGTRRFNEQVVEEWKHALGEV

ProfileScan: PS50104
IPR000157
23-163 TIR
Toll/interleukin-1 receptor homology (TIR) domain

DYYEVFLSFCGGDTRTGLTDNLYRKLVEAGVYVYRDNNELHIGEVFGPELLNAIPRSGILIPILSENYGSREWCLHELTQMMECKRNNGRYMVVPVFYKVKPAHVRHQTGIFGERFQSGTRRFNEQVVEEWKHALGEVSSI

HMMSmart: SM00255
IPR000157
24-163 Toll
Toll/interleukin-1 receptor homology (TIR) domain

YYEVFLSFCGGDTRTGLTDNLYRKLVEAGVYVYRDNNELHIGEVFGPELLNAIPRSGILIPILSENYGSREWCLHELTQMMECKRNNGRYMVVPVFYKVKPAHVRHQTGIFGERFQSGTRRFNEQVVEEWKHALGEVSSI

HMMPfam: PF01582
IPR000157
27-157 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFCGGDTRTGLTDNLYRKLVEAGVYVYRDNNELHIGEVFGPELLNAIPRSGILIPILSENYGSREWCLHELTQMMECKRNNGRYMVVPVFYKVKPAHVRHQTGIFGERFQSGTRRFNEQVVEEWKHAL

HMMPanther: PTHR23155:SF247
36-183 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

TRTGLTDNLYRKLVEAGVYVYRDNNELHIGEVFGPELLNAIPRSGILIPILSENYGSREWCLHELTQMMECKRNNGRYMVVPVFYKVKPAHVRHQTGIFGERFQSGTRRFNEQVVEEWKHALGEVSSILGYEYEEGQETEMIEKVVEQ

HMMPanther: PTHR23155
36-183 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRTGLTDNLYRKLVEAGVYVYRDNNELHIGEVFGPELLNAIPRSGILIPILSENYGSREWCLHELTQMMECKRNNGRYMVVPVFYKVKPAHVRHQTGIFGERFQSGTRRFNEQVVEEWKHALGEVSSILGYEYEEGQETEMIEKVVEQ

Coil: coil
207-228 coiled-coil

KEDYHCELTRLVEENRGAEERE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox