PRGDB00160663 (Glyma09g33230.1)

From PRG Wiki
Jump to: navigation, search
Glyma09g33230.1
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CN
Domain Type Ser-Thr Kinase, NBS
Gene Species Glycine max

Comment?

U-box domain-containing protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGATGCAATCCAAACCGAGAAAATCTACGTTGCTGTTGGTAATGATGTGCAAGATGGACTTAAGACTTTGAATTGGGCTCTCAAGAAGTGGAATTCTCATCCAATTTCCATTGCTGTTCTCCATGTCACACACAATAGTACCAAGGATTATGTCTATACACCATTTGGGAAACTTCCTGCAAGATCTGTGAGTGAGGAGAAACTACAAATTCTCAGGAAAGATGAGCAGGATAAAATCAACAAGCTGCTTTCCAAGTATATTGCTTTTTGTGGCAAGTGGTTCAGTCTAACTATAGTCTTCTGTTTCTGCATATTACAGGTGCCAGCAGAGATTCTTGAAGTTGAGAAATTTGATGAACCTATGCAAAAGCGCGTCATAGACTTGATCTTTGGTCTAGGAATAACCAAATTGGTCATGGGATTTTCATTCATGAAGCCATCCATGAAATCTAAAGGTGCTATTAGTGGATTGTTCTATGTTCATCAGCACAAGCCTTCCTTCTGTGAATTGTTCATTATTTGTGGAGGGAAGCAAGTTTTCCTCAGAGGAAAAAATGATGAGAAAATCATGGAGGATGATCGCGGGGTCATGAATAGAAGTACATCACTTTCCTCAACCAATTTGGAGTCCCCTCTGAACCAAAACCAGTGGGAATTTTACCTCCAGGAAATTGAAAAATACTATCAAGAATTGTTGTCTTCGAACTTGGAGGAAGGAAACTGCGTGCTAGAAAATGACGACTCACAGATTGGACCAATTGAGCCACATAGTGCTGCGGATAAAATTGAGATCCTGAAAAATAAGCTTAATGAAGCTCAGAAGATTATCCAATTAAAGAGGAAAGAAGCCAAGGATAATATAGAGAGGCATACTAAAGCTGAATGGGCAATTTGTTTATGCAACAGTCGGGCCGAAGAACTGGAAAGTCGAATACGAGAAGAGGCGAGTGCAAGAGAGGAGCTAAAGAAGGAATCAGACGCAGAGAAAGAGCAAACAGTGGAGATGAAAACGGAGCTGGAAGAGAGGAAGAGGAGCCTGAGATCCCTGACGGAAGTTCAATCGGAGCTCTCAAACAGGCTTCAAATATGGACGTTGGCGAAGACGCGGGCGGAGACGCAGCTGGAGAAGGCGGTGGGGGAGAGGAGCGAGATGGTGAGGGAGATAGAGGAGCTGAGGCGGCAGAGGGACGTGTTCAATCGGAGGATCGAGTTTTGCAAGGAGAAGGACGCCATCGGAATGGCCGCGAGCCTCGCCGAGATGACGTGCTGCGCATTCAGGGAGTACACCGAGGAGGAGCTCCGGTTGGCGACGGATAACTTCTCCGACCGCCTCAGGTTCAAGTCCGGCGGGGATTGGACTAATGTGTATAGAGGACGCTTTAACCATTCCTCTGTTGCTATCAAGATGCTTCCTTCTTTGTCACACCAACATTTCCAATCCAAGGTGAGGCTTCTTGGTGATATTAGGCAACCTCATCTGGTTGCCATGGTAGGCTTTTGCTCCGAGCCCAAATGCATAGTTTTGGAATACATGGGCAATGGAAGCTTACGTGACATGCTGTTTTCTAGGAGAAGAAACCGGGTCTTACGATGGCATGACCGAATACGAATAGCCACGGAAGTTTGTTCGGGTCTGGGCTTTCTCAATGCAGCTGAGTTGAGGCCCGCTATTCATTGTCATTTGAGCTCATCAAAAATCCTCTTAGACCGCAATTTGGTTGCAAAGATCACGGGCTTTGGGCTTCTTGAATGCCATGATGAGCAATGTAACGTTGAGTCAGATTTGCAAGCCATAGGGGTTTTGTTGATACATCTTCTGACGGGAAGAAATTGGGCCGGGCTCGTCGAGGAGGTGATGACAGTGGATATGGATAGGAAGGCTTTGGGTAGTGTTCTTGATGAGATGGCTGGACAATGGCCATTGGATCTTGCAAGGGAACTTGCTGCCCTGGCTATGAGGTGCATGTCCATCAAAGCCAAACCCAACTCAGAACTCAGCATTGCTAGGGTTTTAGAGGAACTCAATGAGATAAGAAGAAACGGGGATGAAATAGTTGAAAGGGAAGGGCCAAAGACAATTATTGGTGGATGTATAGATAGGGCAGGTTCCAGTGATATGCCTAGTGTTTTCCTTTGCCCCATACTTCAGGAGGCAATGACAAACCCACACGTGGCAGCAGATGGATTTTCTTATGAGCTAGAAGCAATAGAACACTGGCTGCAGTCGGGGCGTGACACATCACCAATGACAAATTTGAGGCTGAAGCACACATTCCTCACCCCTAATCACACCCTTCGTTCCCTAATTCAGGACTGGCAGACCAACAAATCAACCTAG


Protein sequences

Name Description Sequence
Glyma09g33230.1 U-box domain-containing protein kinase family protein (best arabidopsis hit)

MDAIQTEKIYVAVGNDVQDGLKTLNWALKKWNSHPISIAVLHVTHNSTKDYVYTPFGKLPARSVSEEKLQILRKDEQDKINKLLSKYIAFCGKWFSLTIVFCFCILQVPAEILEVEKFDEPMQKRVIDLIFGLGITKLVMGFSFMKPSMKSKGAISGLFYVHQHKPSFCELFIICGGKQVFLRGKNDEKIMEDDRGVMNRSTSLSSTNLESPLNQNQWEFYLQEIEKYYQELLSSNLEEGNCVLENDDSQIGPIEPHSAADKIEILKNKLNEAQKIIQLKRKEAKDNIERHTKAEWAICLCNSRAEELESRIREEASAREELKKESDAEKEQTVEMKTELEERKRSLRSLTEVQSELSNRLQIWTLAKTRAETQLEKAVGERSEMVREIEELRRQRDVFNRRIEFCKEKDAIGMAASLAEMTCCAFREYTEEELRLATDNFSDRLRFKSGGDWTNVYRGRFNHSSVAIKMLPSLSHQHFQSKVRLLGDIRQPHLVAMVGFCSEPKCIVLEYMGNGSLRDMLFSRRRNRVLRWHDRIRIATEVCSGLGFLNAAELRPAIHCHLSSSKILLDRNLVAKITGFGLLECHDEQCNVESDLQAIGVLLIHLLTGRNWAGLVEEVMTVDMDRKALGSVLDEMAGQWPLDLARELAALAMRCMSIKAKPNSELSIARVLEELNEIRRNGDEIVEREGPKTIIGGCIDRAGSSDMPSVFLCPILQEAMTNPHVAADGFSYELEAIEHWLQSGRDTSPMTNLRLKHTFLTPNHTLRSLIQDWQTNKST*

Domains

Domain Start-End Description Sequence

Coil: coil
263-288 coiled-coil

IEILKNKLNEAQKIIQLKRKEAKDNI

Seg: seg
303-322 seg

SRAEELESRIREEASAREEL

Coil: coil
305-344 coiled-coil

AEELESRIREEASAREELKKESDAEKEQTVEMKTELEERK

Coil: coil
375-410 coiled-coil

LEKAVGERSEMVREIEELRRQRDVFNRRIEFCKEKD

HMMPanther: PTHR24420
378-753 FAMILY NOT NAMED,FAMILY NOT NAMED

AVGERSEMVREIEELRRQRDVFNRRIEFCKEKDAIGMAASLAEMTCCAFREYTEEELRLATDNFSDRLRFKSGGDWTNVYRGRFNHSSVAIKMLPSLSHQHFQSKVRLLGDIRQPHLVAMVGFCSEPKCIVLEYMGNGSLRDMLFSRRRNRVLRWHDRIRIATEVCSGLGFLNAAELRPAIHCHLSSSKILLDRNLVAKITGFGLLECHDEQCNVESDLQAIGVLLIHLLTGRNWAGLVEEVMTVDMDRKALGSVLDEMAGQWPLDLARELAALAMRCMSIKAKPNSELSIARVLEELNEIRRNGDEIVEREGPKTIIGGCIDRAGSSDMPSVFLCPILQEAMTNPHVAADGFSYELEAIEHWLQSGRDTSPMTNL

HMMPanther: PTHR24420:SF934
378-753 PROTEIN KINASE FAMILY PROTEIN

AVGERSEMVREIEELRRQRDVFNRRIEFCKEKDAIGMAASLAEMTCCAFREYTEEELRLATDNFSDRLRFKSGGDWTNVYRGRFNHSSVAIKMLPSLSHQHFQSKVRLLGDIRQPHLVAMVGFCSEPKCIVLEYMGNGSLRDMLFSRRRNRVLRWHDRIRIATEVCSGLGFLNAAELRPAIHCHLSSSKILLDRNLVAKITGFGLLECHDEQCNVESDLQAIGVLLIHLLTGRNWAGLVEEVMTVDMDRKALGSVLDEMAGQWPLDLARELAALAMRCMSIKAKPNSELSIARVLEELNEIRRNGDEIVEREGPKTIIGGCIDRAGSSDMPSVFLCPILQEAMTNPHVAADGFSYELEAIEHWLQSGRDTSPMTNL

Gene3D: G3DSA:3.30.200.20
427-499 no description

REYTEEELRLATDNFSDRLRFKSGGDWTNVYRGRFNHSSVAIKMLPSLSHQHFQSKVRLLGDIRQPHLVAMVG

superfamily: SSF56112
IPR011009
430-704 Protein kinase-like (PK-like)
Protein kinase-like domain

TEEELRLATDNFSDRLRFKSGGDWTNVYRGRFNHSSVAIKMLPSLSHQHFQSKVRLLGDIRQPHLVAMVGFCSEPKCIVLEYMGNGSLRDMLFSRRRNRVLRWHDRIRIATEVCSGLGFLNAAELRPAIHCHLSSSKILLDRNLVAKITGFGLLECHDEQCNVESDLQAIGVLLIHLLTGRNWAGLVEEVMTVDMDRKALGSVLDEMAGQWPLDLARELAALAMRCMSIKAKPNSELSIARVLEELNEIRRNGDEIVEREGPKTIIGGCIDRAGS

HMMSmart: SM00220
IPR002290
442-672 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

SDRLRFKSGGDWTNVYRGRFNHSSVAIKMLPSLSHQHFQSKVRLLGDIRQPHLVAMVGFCSEPKCIVLEYMGNGSLRDMLFSRRRNRVLRWHDRIRIATEVCSGLGFLNAAELRPAIHCHLSSSKILLDRNLVAKITGFGLLECHDEQCNVESDLQAIGVLLIHLLTGRNWAGLVEEVMTVDMDRKALGSVLDEMAGQWPLDLARELAALAMRCMSIKAKPNSELSIARVL

ProfileScan: PS50011
IPR000719
442-695 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

SDRLRFKSGGDWTNVYRGRFNHSSVAIKMLPSLSHQHFQSKVRLLGDIRQPHLVAMVGFCSEPKCIVLEYMGNGSLRDMLFSRRRNRVLRWHDRIRIATEVCSGLGFLNAAELRPAIHCHLSSSKILLDRNLVAKITGFGLLECHDEQCNVESDLQAIGVLLIHLLTGRNWAGLVEEVMTVDMDRKALGSVLDEMAGQWPLDLARELAALAMRCMSIKAKPNSELSIARVLEELNEIRRNGDEIVEREGPKTII

HMMSmart: SM00219
IPR020635
445-675 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LRFKSGGDWTNVYRGRFNHSSVAIKMLPSLSHQHFQSKVRLLGDIRQPHLVAMVGFCSEPKCIVLEYMGNGSLRDMLFSRRRNRVLRWHDRIRIATEVCSGLGFLNAAELRPAIHCHLSSSKILLDRNLVAKITGFGLLECHDEQCNVESDLQAIGVLLIHLLTGRNWAGLVEEVMTVDMDRKALGSVLDEMAGQWPLDLARELAALAMRCMSIKAKPNSELSIARVLEEL

HMMPfam: PF07714
IPR001245
451-589 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

GDWTNVYRGRFNHSSVAIKMLPSLSHQHFQSKVRLLGDIRQPHLVAMVGFCSEPKCIVLEYMGNGSLRDMLFSRRRNRVLRWHDRIRIATEVCSGLGFLNAAELRPAIHCHLSSSKILLDRNLVAKITGFGLLECHDEQ

Gene3D: G3DSA:1.10.510.10
500-584 no description

FCSEPKCIVLEYMGNGSLRDMLFSRRRNRVLRWHDRIRIATEVCSGLGFLNAAELRPAIHCHLSSSKILLDRNLVAKITGFGLLE

Gene3D: G3DSA:3.30.40.10
IPR013083
706-777 no description
Zinc finger, RING/FYVE/PHD-type

DMPSVFLCPILQEAMTNPHVAADGFSYELEAIEHWLQSGRDTSPMTNLRLKHTFLTPNHTLRSLIQDWQTNK

superfamily: SSF57850
706-778 RING/U-box,NBS

DMPSVFLCPILQEAMTNPHVAADGFSYELEAIEHWLQSGRDTSPMTNLRLKHTFLTPNHTLRSLIQDWQTNKS

HMMPfam: PF04564
IPR003613
708-778 U-box
U box domain

PSVFLCPILQEAMTNPHVAADGFSYELEAIEHWLQSGRDTSPMTNLRLKHTFLTPNHTLRSLIQDWQTNKS

HMMSmart: SM00504
IPR003613
710-773 Modified RING finger domain
U box domain

VFLCPILQEAMTNPHVAADGFSYELEAIEHWLQSGRDTSPMTNLRLKHTFLTPNHTLRSLIQDW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox