PRGDB00162662 (Egrandis_v1_0.023332m)

From PRG Wiki
Jump to: navigation, search
Egrandis_v1_0.023332m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class T
Domain Type TIR, LRR
Gene Species Areca catechu

Comment?

Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

ATGGCTCTGCAACTGTGGGAGACCCTCAAAGAATCCATCGTCGCCTTCACGGGCCTGTCCCCGGCGACTTTCTTCACCGTCCTCGCCCTCGGGCTCACCGTCCACTATGTTGTGTCTGGCCTCTTCGGGTCGCTATCCGACCGCCACCAGAGGCCAAGGGACTACCAGGAGCAGATGCAGCCTCTCCCTCCCCCTGTTCAGCTTGTCGAGACCTCCGACGACGAGCTCAAGCAGCACGACGGCACCGACCCCAAGAAGTCTCTCTTGATGGCCAACAGGGGGCAGATCTACGATGTCTCTCAGCGCAGAAGGAGCTATGATGTCTTTCTAAGTTTTAGAGGCACAGATGTCCGCAACTATTTCCTTGGTCATCTCTACACAGCTCTCGTTCAAAGTGGAATAAACACTTACATGGACAGTGAAGATCTAAATAAGGGAGAGCAAATATCACCTGCACTCATGGAGACAATTGAGGAATCGCAAATTGCAATCATTGTTTTCTCCAAGGACTATGCCTCATCACCATGGTGTTTGGAGGAGGTGGCGAAAATCATGGAGTGCAAGGAGCAAAGAGGCCTCATGGTCTTTCCGGTGTTTTACAAAGTGGAACCTAGAGAAGTGAGAGGGCAGAGACAGGGTTATGCAAAAGCTATGGCCAAATTTGTGGTCAAATTTGGGGAGGATTCAGAGAAAGTAAAGCTATGGAAGAAAGCTCTTCTTGATGCTGGGAGCTTGTCTGGATGGCATTTTATGGATGGGTACGTGAAAACACTTCTACTGCTTCAAATGGTGTAA


Protein sequences

Name Description Sequence
Egrandis_v1_0.023332m Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

MALQLWETLKESIVAFTGLSPATFFTVLALGLTVHYVVSGLFGSLSDRHQRPRDYQEQMQPLPPPVQLVETSDDELKQHDGTDPKKSLLMANRGQIYDVSQRRRSYDVFLSFRGTDVRNYFLGHLYTALVQSGINTYMDSEDLNKGEQISPALMETIEESQIAIIVFSKDYASSPWCLEEVAKIMECKEQRGLMVFPVFYKVEPREVRGQRQGYAKAMAKFVVKFGEDSEKVKLWKKALLDAGSLSGWHFMDGYVKTLLLLQMV*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10281:SF26
1-106 MEMBRANE STEROID BINDING PROTEIN,MEMBRANE STEROID BINDING PROTEIN

MALQLWETLKESIVAFTGLSPATFFTVLALGLTVHYVVSGLFGSLSDRHQRPRDYQEQMQPLPPPVQLVETSDDELKQHDGTDPKKSLLMANRGQIYDVSQRRRSY

HMMPanther: PTHR10281
1-106 MEMBRANE-ASSOCIATED PROGESTERONE RECEPTOR COMPONENT-RELATED,MEMBRANE-ASSOCIATED PROGESTERONE RECEPTOR COMPONENT-RELATED

MALQLWETLKESIVAFTGLSPATFFTVLALGLTVHYVVSGLFGSLSDRHQRPRDYQEQMQPLPPPVQLVETSDDELKQHDGTDPKKSLLMANRGQIYDVSQRRRSY

Seg: seg
56-70 seg

QEQMQPLPPPVQLVE

Gene3D: G3DSA:3.10.120.10
IPR001199
72-111 no description
Cytochrome b5

SDDELKQHDGTDPKKSLLMANRGQIYDVSQRRRSYDVFLS

HMMPfam: PF00173
IPR001199
73-145 Cyt-b5
Cytochrome b5

DDELKQHDGTDPKKSLLMANRGQIYDVSQRRRSYDVFLSFRGTDVRNYFLGHLYTALVQSGINTYMDSEDLNK

superfamily: SSF52200
IPR000157
94-248 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

GQIYDVSQRRRSYDVFLSFRGTDVRNYFLGHLYTALVQSGINTYMDSEDLNKGEQISPALMETIEESQIAIIVFSKDYASSPWCLEEVAKIMECKEQRGLMVFPVFYKVEPREVRGQRQGYAKAMAKFVVKFGEDSEKVKLWKKALLDAGSLSGW

ProfileScan: PS50104
IPR000157
104-245 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RSYDVFLSFRGTDVRNYFLGHLYTALVQSGINTYMDSEDLNKGEQISPALMETIEESQIAIIVFSKDYASSPWCLEEVAKIMECKEQRGLMVFPVFYKVEPREVRGQRQGYAKAMAKFVVKFGEDSEKVKLWKKALLDAGSL

HMMSmart: SM00255
IPR000157
105-245 Toll
Toll/interleukin-1 receptor homology (TIR) domain

SYDVFLSFRGTDVRNYFLGHLYTALVQSGINTYMDSEDLNKGEQISPALMETIEESQIAIIVFSKDYASSPWCLEEVAKIMECKEQRGLMVFPVFYKVEPREVRGQRQGYAKAMAKFVVKFGEDSEKVKLWKKALLDAGSL

HMMPfam: PF01582
IPR000157
108-239 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGTDVRNYFLGHLYTALVQSGINTYMDSEDLNKGEQISPALMETIEESQIAIIVFSKDYASSPWCLEEVAKIMECKEQRGLMVFPVFYKVEPREVRGQRQGYAKAMAKFVVKFGEDSEKVKLWKKAL

Gene3D: G3DSA:3.40.50.10140
112-239 no description

FRGTDVRNYFLGHLYTALVQSGINTYMDSEDLNKGEQISPALMETIEESQIAIIVFSKDYASSPWCLEEVAKIMECKEQRGLMVFPVFYKVEPREVRGQRQGYAKAMAKFVVKFGEDSEKVKLWKKAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox