PRGDB00162944 (Egrandis_v1_0.046129m)

From PRG Wiki
Jump to: navigation, search
Egrandis_v1_0.046129m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class T
Domain Type TIR, LRR
Gene Species Areca catechu

Comment?

Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

ATGCAGATGCAGCCTCTCTCTCCTCCTGTTCAGCTTGTCGAGACCTCCGAGGACGAGCTCAAGCAGTACGACGGCAGCGACCCCAAGAAGTCTCTTGATGGCCACAGGGGGCAGATCTACGATGTCTCTCAACGCAGAAGGAACTATGATGTCTTTCTGAGTTTTAGAGGCATGGATGTCCGCAACTATTTCCTTGGTCATCTCTACACAGCTCTTGATCAAAGTGGAATAAACACTTACATGGACAGCGAAGATCTAAAGAAGGGAGAGCAAATATCACCCGCACTTATGGAGGTAATCAAGGAATCACAAATAGCGATCGTTGTTTTCTCCAAGGACTATGCCTCATCACCA


Protein sequences

Name Description Sequence
Egrandis_v1_0.046129m Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

MQMQPLSPPVQLVETSEDELKQYDGSDPKKSLDGHRGQIYDVSQRRRNYDVFLSFRGMDVRNYFLGHLYTALDQSGINTYMDSEDLKKGEQISPALMEVIKESQIAIVVFSKDYASSP

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.10.120.10
IPR001199
15-54 no description
Cytochrome b5

TSEDELKQYDGSDPKKSLDGHRGQIYDVSQRRRNYDVFLS

superfamily: SSF52200
IPR000157
37-118 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

GQIYDVSQRRRNYDVFLSFRGMDVRNYFLGHLYTALDQSGINTYMDSEDLKKGEQISPALMEVIKESQIAIVVFSKDYASSP

ProfileScan: PS50104
IPR000157
47-118 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RNYDVFLSFRGMDVRNYFLGHLYTALDQSGINTYMDSEDLKKGEQISPALMEVIKESQIAIVVFSKDYASSP

HMMPfam: PF01582
IPR000157
51-117 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGMDVRNYFLGHLYTALDQSGINTYMDSEDLKKGEQISPALMEVIKESQIAIVVFSKDYASS

Gene3D: G3DSA:3.40.50.10140
55-118 no description

FRGMDVRNYFLGHLYTALDQSGINTYMDSEDLKKGEQISPALMEVIKESQIAIVVFSKDYASSP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox