PRGDB00163053 (Egrandis_v1_0.026428m)

From PRG Wiki
Jump to: navigation, search
Egrandis_v1_0.026428m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class TNL
Domain Type NBS, TIR, LRR
Gene Species Areca catechu

Comment?

Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

ATGAAGCCTCTCCCTCCTCGTGTTCAGCTTGTCGAGACCTCCGAGGACGAGCTCAAGCAGTACGACGGCACCAACCCCAAGAAGTCTCTCTTGATGGCCAACAGGGGGCAGATCTACGATGTCTCTCAGAGCAGAAAGAGTTACGATGTCTTCCTAAGTTTCAGAGGCACAGACGTCCGCAATAACTTTCTTGGTCATCTCTACATAGCTCTAGACCAGAGAGGAATTAACACTTACATCGATAGTGAAGAATTGAGGAAGGGAGAGCAAATATCACCTGCACTTATGGAGGCAATCAAGGAATCGCAAATCGCCATCGTAGTTTTCTCCGAGAACTACGCCTCATCAAAGTGGTGTTTGGATGAGCTAGCAGAAATCATGGAGTGCAAGGAGCAAAGAAACCTAGTAGTTTTTTCGGTGTTTTACAAAGTGGAACCTAGAGAAGTGAGAACACCAGGGAAAGGGGACAGACAGAGTTATGGAAAAGCTATGGCCGAGCATGAGGTCAACTTTGGGAAGGATTCAGAGAAAGTAAAGAGATGGAAAAAAGCTCTTTCAAACGTTGGTAGCTTGTCTGGATGGCATGTTACTGAAAATGAGTACGTGACAACTCTTCTGCTACTTCAATTAGTTTATTTCTTTTGA


Protein sequences

Name Description Sequence
Egrandis_v1_0.026428m Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

MKPLPPRVQLVETSEDELKQYDGTNPKKSLLMANRGQIYDVSQSRKSYDVFLSFRGTDVRNNFLGHLYIALDQRGINTYIDSEELRKGEQISPALMEAIKESQIAIVVFSENYASSKWCLDELAEIMECKEQRNLVVFSVFYKVEPREVRTPGKGDRQSYGKAMAEHEVNFGKDSEKVKRWKKALSNVGSLSGWHVTENEYVTTLLLLQLVYFF*

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.10.120.10
IPR001199
13-53 no description
Cytochrome b5

TSEDELKQYDGTNPKKSLLMANRGQIYDVSQSRKSYDVFLS

HMMPfam: PF00173
IPR001199
14-76 Cyt-b5
Cytochrome b5

SEDELKQYDGTNPKKSLLMANRGQIYDVSQSRKSYDVFLSFRGTDVRNNFLGHLYIALDQRGI

superfamily: SSF52200
IPR000157
36-194 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

GQIYDVSQSRKSYDVFLSFRGTDVRNNFLGHLYIALDQRGINTYIDSEELRKGEQISPALMEAIKESQIAIVVFSENYASSKWCLDELAEIMECKEQRNLVVFSVFYKVEPREVRTPGKGDRQSYGKAMAEHEVNFGKDSEKVKRWKKALSNVGSLSGW

ProfileScan: PS50104
IPR000157
46-191 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KSYDVFLSFRGTDVRNNFLGHLYIALDQRGINTYIDSEELRKGEQISPALMEAIKESQIAIVVFSENYASSKWCLDELAEIMECKEQRNLVVFSVFYKVEPREVRTPGKGDRQSYGKAMAEHEVNFGKDSEKVKRWKKALSNVGSL

HMMSmart: SM00255
IPR000157
47-191 Toll
Toll/interleukin-1 receptor homology (TIR) domain

SYDVFLSFRGTDVRNNFLGHLYIALDQRGINTYIDSEELRKGEQISPALMEAIKESQIAIVVFSENYASSKWCLDELAEIMECKEQRNLVVFSVFYKVEPREVRTPGKGDRQSYGKAMAEHEVNFGKDSEKVKRWKKALSNVGSL

HMMPfam: PF01582
IPR000157
50-186 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGTDVRNNFLGHLYIALDQRGINTYIDSEELRKGEQISPALMEAIKESQIAIVVFSENYASSKWCLDELAEIMECKEQRNLVVFSVFYKVEPREVRTPGKGDRQSYGKAMAEHEVNFGKDSEKVKRWKKALS

Gene3D: G3DSA:3.40.50.10140
54-185 no description

FRGTDVRNNFLGHLYIALDQRGINTYIDSEELRKGEQISPALMEAIKESQIAIVVFSENYASSKWCLDELAEIMECKEQRNLVVFSVFYKVEPREVRTPGKGDRQSYGKAMAEHEVNFGKDSEKVKRWKKAL

HMMPanther: PTHR23155
59-195 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VRNNFLGHLYIALDQRGINTYIDSEELRKGEQISPALMEAIKESQIAIVVFSENYASSKWCLDELAEIMECKEQRNLVVFSVFYKVEPREVRTPGKGDRQSYGKAMAEHEVNFGKDSEKVKRWKKALSNVGSLSGWH

HMMPanther: PTHR23155:SF298
59-195 DISEASE RESISTANCE PROTEIN RPP1-WSB-LIKE (TIR-NBS-LRR CLASS), PUTATIVE

VRNNFLGHLYIALDQRGINTYIDSEELRKGEQISPALMEAIKESQIAIVVFSENYASSKWCLDELAEIMECKEQRNLVVFSVFYKVEPREVRTPGKGDRQSYGKAMAEHEVNFGKDSEKVKRWKKALSNVGSLSGWH

Seg: seg
201-214 seg

YVTTLLLLQLVYFF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox