PRGDB00164678 (cassava4.1_026013m)

From PRG Wiki
Jump to: navigation, search
cassava4.1_026013m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Vitis aestivalis

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

AAGCTTGCAGGATTCTGCAATGGGAAGGAAGATGTATATAACCATGATGGTATCATAGGCTACCCACCACTGATCGGCTTTTCTTACATAGAAGGACTGAGTTGCCTATGGATTCTCCATGGGAAACCAGGAACTCTTGTATCATTAAGTTTCACCCATATCAACATCTCAGAAGACTTTGATTTTCTTGCCATATATAATGGCGCAAAGCAGCAGGTAGCTAACTTCTCTGGCTATTATTCTGGGTCTGGTCTCCCGCATTTGAACTTGACTGGTGAAGTTAGGATTGCATTTGCTACTCAGACAGAAAAAGGGCAAGGTTGGTCAGCTAATTATTTCATTGCATCTCCTGTGAGTCGCAATAGCAAAACATTCCTTGTCATCATCATTGTTGTTTCAGCTGTTGGAGTAAGCATTTCTCTTGCTTTCATAGCCTTCGCCTTGCGCAAAAATAGAAGCAGGTGCAGTTATGCAATGGATTCAGATGAGAGCCTGATGCTAATGAGACTAGAAACGATCAGAGATGAAAACCTAATTGGGGAGGGGCCTTCTGCAGTTGTTTACAGAGCAGTTTTGACGGATGGGAAGTGTATAGCAGTCAAAGCTCCTAAAGGTACAGCTTCTCCAGTTGACTTAGAGAGGGAGATATTGAGTAAATCCTCTTCCCACCCAAATATCATATCTTTAGTTGGATATGCACACGATGGACTCCAAAGACATTACTTGGCGTTTGAATTCATGAGTGGGGGCAATTTGAGGATGAACTTGATGGAAAGAGGAGAAAGACTAGACTGGGAGAAGAGATTAGCTATAGCATTACAGATCTGCTCTGCAATCCAAATGCTTCACATGTATCTGAAACCACCTATTTATCATGGCAATATAGCATCTGAGAATATTCTCCTTGATGAATTAAGCAATGCAAAATTAGCTGGTTTCAGCAAGGCAGATTATTGCAGCAACAACAGGATGAATCCTGGAGACTTGTCTGAAATGGCAGAAGATATTTGGAGTTTTGGAATAGTTTTGGTTGAGCTTTTAAGAGGACAGAACCTAGATGATAGAAATGCCTACAAAAATTTCAGGAGCCTTGAAGAGGTAAATGAGTTTGTTGGCAACCATGAGCACTTTGATCGACGATTGGGTATTCCTGATGAACAAAGTAGGATCATGGGTCTAGCAAAGTTGGGTGAAATTGCAAAATGGTGCATTGGTCTTGGCTGTGGAGTTGAAAGGGAAAGAAATAATCCTCAGATAGGTGATGTTTTGTCAGGCTTGAAGCAGGTGAAGCAAATGTTTTGTTGTGTGTGA


Protein sequences

Name Description Sequence
cassava4.1_026013m Protein kinase superfamily protein (best arabidopsis hit)

KLAGFCNGKEDVYNHDGIIGYPPLIGFSYIEGLSCLWILHGKPGTLVSLSFTHINISEDFDFLAIYNGAKQQVANFSGYYSGSGLPHLNLTGEVRIAFATQTEKGQGWSANYFIASPVSRNSKTFLVIIIVVSAVGVSISLAFIAFALRKNRSRCSYAMDSDESLMLMRLETIRDENLIGEGPSAVVYRAVLTDGKCIAVKAPKGTASPVDLEREILSKSSSHPNIISLVGYAHDGLQRHYLAFEFMSGGNLRMNLMERGERLDWEKRLAIALQICSAIQMLHMYLKPPIYHGNIASENILLDELSNAKLAGFSKADYCSNNRMNPGDLSEMAEDIWSFGIVLVELLRGQNLDDRNAYKNFRSLEEVNEFVGNHEHFDRRLGIPDEQSRIMGLAKLGEIAKWCIGLGCGVERERNNPQIGDVLSGLKQVKQMFCCV*

Domains

Domain Start-End Description Sequence

superfamily: SSF49854
IPR000859
5-116 Spermadhesin, CUB domain
CUB

FCNGKEDVYNHDGIIGYPPLIGFSYIEGLSCLWILHGKPGTLVSLSFTHINISEDFDFLAIYNGAKQQVANFSGYYSGSGLPHLNLTGEVRIAFATQTEKGQGWSANYFIAS

ProfileScan: PS01180
IPR000859
6-115 CUB
CUB

CNGKEDVYNHDGIIGYPPLIGFSYIEGLSCLWILHGKPGTLVSLSFTHINISEDFDFLAIYNGAKQQVANFSGYYSGSGLPHLNLTGEVRIAFATQTEKGQGWSANYFIA

HMMSmart: SM00042
IPR000859
6-115 Domain first found in C1r, C1s, uEGF, and bo
CUB

CNGKEDVYNHDGIIGYPPLIGFSYIEGLSCLWILHGKPGTLVSLSFTHINISEDFDFLAIYNGAKQQVANFSGYYSGSGLPHLNLTGEVRIAFATQTEKGQGWSANYFIA

Gene3D: G3DSA:2.60.120.290
IPR000859
14-113 no description
CUB

NHDGIIGYPPLIGFSYIEGLSCLWILHGKPGTLVSLSFTHINISEDFDFLAIYNGAKQQVANFSGYYSGSGLPHLNLTGEVRIAFATQTEKGQGWSANYF

HMMPfam: PF00431
IPR000859
28-112 CUB
CUB

SYIEGLSCLWILHGKPGTLVSLSFTHINISEDFDFLAIYNGAKQQVANFSGYYSGSGLPHLNLTGEVRIAFATQTEKGQGWSANY

HMMPanther: PTHR24420
120-404 FAMILY NOT NAMED,FAMILY NOT NAMED

RNSKTFLVIIIVVSAVGVSISLAFIAFALRKNRSRCSYAMDSDESLMLMRLETIRDENLIGEGPSAVVYRAVLTDGKCIAVKAPKGTASPVDLEREILSKSSSHPNIISLVGYAHDGLQRHYLAFEFMSGGNLRMNLMERGERLDWEKRLAIALQICSAIQMLHMYLKPPIYHGNIASENILLDELSNAKLAGFSKADYCSNNRMNPGDLSEMAEDIWSFGIVLVELLRGQNLDDRNAYKNFRSLEEVNEFVGNHEHFDRRLGIPDEQSRIMGLAKLGEIAKWCI

Seg: seg
127-140 seg

VIIIVVSAVGVSIS

superfamily: SSF56112
IPR011009
162-350 Protein kinase-like (PK-like)
Protein kinase-like domain

DESLMLMRLETIRDENLIGEGPSAVVYRAVLTDGKCIAVKAPKGTASPVDLEREILSKSSSHPNIISLVGYAHDGLQRHYLAFEFMSGGNLRMNLMERGERLDWEKRLAIALQICSAIQMLHMYLKPPIYHGNIASENILLDELSNAKLAGFSKADYCSNNRMNPGDLSEMAEDIWSFGIVLVELLRGQ

HMMSmart: SM00219
IPR020635
173-400 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

IRDENLIGEGPSAVVYRAVLTDGKCIAVKAPKGTASPVDLEREILSKSSSHPNIISLVGYAHDGLQRHYLAFEFMSGGNLRMNLMERGERLDWEKRLAIALQICSAIQMLHMYLKPPIYHGNIASENILLDELSNAKLAGFSKADYCSNNRMNPGDLSEMAEDIWSFGIVLVELLRGQNLDDRNAYKNFRSLEEVNEFVGNHEHFDRRLGIPDEQSRIMGLAKLGEIA

ProfileScan: PS50011
IPR000719
173-436 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

IRDENLIGEGPSAVVYRAVLTDGKCIAVKAPKGTASPVDLEREILSKSSSHPNIISLVGYAHDGLQRHYLAFEFMSGGNLRMNLMERGERLDWEKRLAIALQICSAIQMLHMYLKPPIYHGNIASENILLDELSNAKLAGFSKADYCSNNRMNPGDLSEMAEDIWSFGIVLVELLRGQNLDDRNAYKNFRSLEEVNEFVGNHEHFDRRLGIPDEQSRIMGLAKLGEIAKWCIGLGCGVERERNNPQIGDVLSGLKQVKQMFCCV

HMMSmart: SM00220
IPR002290
173-391 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

IRDENLIGEGPSAVVYRAVLTDGKCIAVKAPKGTASPVDLEREILSKSSSHPNIISLVGYAHDGLQRHYLAFEFMSGGNLRMNLMERGERLDWEKRLAIALQICSAIQMLHMYLKPPIYHGNIASENILLDELSNAKLAGFSKADYCSNNRMNPGDLSEMAEDIWSFGIVLVELLRGQNLDDRNAYKNFRSLEEVNEFVGNHEHFDRRLGIPDEQSRIM

HMMPfam: PF00069
IPR000719
176-356 Pkinase,Ser-thr
Protein kinase, catalytic domain

ENLIGEGPSAVVYRAVLTDGKCIAVKAPKGTASPVDLEREILSKSSSHPNIISLVGYAHDGLQRHYLAFEFMSGGNLRMNLMERGERLDWEKRLAIALQICSAIQMLHMYLKPPIYHGNIASENILLDELSNAKLAGFSKADYCSNNRMNPGDLSEMAEDIWSFGIVLVELLRGQNLDDRN

Gene3D: G3DSA:3.30.200.20
176-269 no description

ENLIGEGPSAVVYRAVLTDGKCIAVKAPKGTASPVDLEREILSKSSSHPNIISLVGYAHDGLQRHYLAFEFMSGGNLRMNLMERGERLDWEKRL

Gene3D: G3DSA:1.10.510.10
270-355 no description

AIALQICSAIQMLHMYLKPPIYHGNIASENILLDELSNAKLAGFSKADYCSNNRMNPGDLSEMAEDIWSFGIVLVELLRGQNLDDR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox