PRGDB00172320 (ppa007540m)

From PRG Wiki
Jump to: navigation, search
ppa007540m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGAGTTTGGCCACAAAACGTTTCCGGCCAGAGCTAATTCTTGGTGAGGGTGGGTTCGGTGTTGTATATAAAGGAGTTGTTGATGACACCGTGAGGACAGGTTACAAGACCACACAAGTTGCCATCAAGGAGCTTAATCGAGAAGGGTACCAAGGTGATAGGGAATGGCTGGCAGAAGTTAACTATCTAGGTCAGCTTAGTCACCCTAATCTTGTGAAGCTGATTGGCTACTGCTGTGAGGATGAGCACCGGCTACTGGTCTATGAATACATGGCAAGTGGCAGCCTGGAAAAACATCTATTTCGCAGAGTGGGCTGTACGCTTACATGGTCAAGAAGAATGAAGATTGCTTTAGATGCTGCAAAAGGGCTTGCTTTTCTTCATGGTGCAGAGCGACCAATCATTTACCGTGACTTTAAGACATCAAATATTTTGTTGGATGGGGATTTTAATGCAAAACTTTCGGACTTCGGCCTTGCAAAGGAAGGGCCTATGGGAGACCAAACCCATGTTTCAACAAGAGTGATGGGCACATATGGATATGCTGCACCTGAGTATGTAATGACTGGGCATCTAACTGCTCGAAGTGATGTTTATGGATTTGGAGTGGTGCTACTTGAGCTGCTCATTGGACGAAGAGCAATGGATAAGAGCAGGCCCAGCCGAGAACACAACCTGGTTGAGTGGGCTCGTCCACTCTTGAACCACAATAAGAAGCTTCTGAGGATTGTAGACCCTAGGTTGGAAGGGCAGTACTCATTTAAAACTGCAATGAAGGTGGCCCAGTTGGCATATCAATGCCTTAGCCAAAACCCAAAAGGGAGGCCCCTTATGAGCCAGGTGGTTGACATCCTCGAGACTCTTCAGTCATCAGGAAACCACGAACTTCAAAGCGGAGATGGTGCTGTAACTCTTTATGAGGCTCCCAAGGGAACAATTGGAAGTCCTGCTAAGAAGAGAAGCCAGAACAGAAGAGACGGTGAAAGGGGAGGAGAGGCGCATAGCAATCCGGGAAATGGAAGGAGCAAGAGTGAGCCTATGAATGATTTCGATCGTAATAACTTGTCTCCAAATTTTGTGTCGCATGAAAAGTAG


Protein sequences

Name Description Sequence
ppa007540m Protein kinase superfamily protein (best arabidopsis hit)

MSLATKRFRPELILGEGGFGVVYKGVVDDTVRTGYKTTQVAIKELNREGYQGDREWLAEVNYLGQLSHPNLVKLIGYCCEDEHRLLVYEYMASGSLEKHLFRRVGCTLTWSRRMKIALDAAKGLAFLHGAERPIIYRDFKTSNILLDGDFNAKLSDFGLAKEGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLELLIGRRAMDKSRPSREHNLVEWARPLLNHNKKLLRIVDPRLEGQYSFKTAMKVAQLAYQCLSQNPKGRPLMSQVVDILETLQSSGNHELQSGDGAVTLYEAPKGTIGSPAKKRSQNRRDGERGGEAHSNPGNGRSKSEPMNDFDRNNLSPNFVSHEK*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF529
1-293 SUBFAMILY NOT NAMED

MSLATKRFRPELILGEGGFGVVYKGVVDDTVRTGYKTTQVAIKELNREGYQGDREWLAEVNYLGQLSHPNLVKLIGYCCEDEHRLLVYEYMASGSLEKHLFRRVGCTLTWSRRMKIALDAAKGLAFLHGAERPIIYRDFKTSNILLDGDFNAKLSDFGLAKEGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLELLIGRRAMDKSRPSREHNLVEWARPLLNHNKKLLRIVDPRLEGQYSFKTAMKVAQLAYQCLSQNPKGRPLMSQVVDILETLQSSGN

HMMPanther: PTHR24420
1-293 FAMILY NOT NAMED,FAMILY NOT NAMED

MSLATKRFRPELILGEGGFGVVYKGVVDDTVRTGYKTTQVAIKELNREGYQGDREWLAEVNYLGQLSHPNLVKLIGYCCEDEHRLLVYEYMASGSLEKHLFRRVGCTLTWSRRMKIALDAAKGLAFLHGAERPIIYRDFKTSNILLDGDFNAKLSDFGLAKEGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLELLIGRRAMDKSRPSREHNLVEWARPLLNHNKKLLRIVDPRLEGQYSFKTAMKVAQLAYQCLSQNPKGRPLMSQVVDILETLQSSGN

superfamily: SSF56112
IPR011009
3-289 Protein kinase-like (PK-like)
Protein kinase-like domain

LATKRFRPELILGEGGFGVVYKGVVDDTVRTGYKTTQVAIKELNREGYQGDREWLAEVNYLGQLSHPNLVKLIGYCCEDEHRLLVYEYMASGSLEKHLFRRVGCTLTWSRRMKIALDAAKGLAFLHGAERPIIYRDFKTSNILLDGDFNAKLSDFGLAKEGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLELLIGRRAMDKSRPSREHNLVEWARPLLNHNKKLLRIVDPRLEGQYSFKTAMKVAQLAYQCLSQNPKGRPLMSQVVDILETLQ

Gene3D: G3DSA:3.30.200.20
3-77 no description

LATKRFRPELILGEGGFGVVYKGVVDDTVRTGYKTTQVAIKELNREGYQGDREWLAEVNYLGQLSHPNLVKLIGY

ProfileScan: PS50011
IPR000719
8-288 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRPELILGEGGFGVVYKGVVDDTVRTGYKTTQVAIKELNREGYQGDREWLAEVNYLGQLSHPNLVKLIGYCCEDEHRLLVYEYMASGSLEKHLFRRVGCTLTWSRRMKIALDAAKGLAFLHGAERPIIYRDFKTSNILLDGDFNAKLSDFGLAKEGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLELLIGRRAMDKSRPSREHNLVEWARPLLNHNKKLLRIVDPRLEGQYSFKTAMKVAQLAYQCLSQNPKGRPLMSQVVDILETL

HMMSmart: SM00220
IPR002290
8-288 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRPELILGEGGFGVVYKGVVDDTVRTGYKTTQVAIKELNREGYQGDREWLAEVNYLGQLSHPNLVKLIGYCCEDEHRLLVYEYMASGSLEKHLFRRVGCTLTWSRRMKIALDAAKGLAFLHGAERPIIYRDFKTSNILLDGDFNAKLSDFGLAKEGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLELLIGRRAMDKSRPSREHNLVEWARPLLNHNKKLLRIVDPRLEGQYSFKTAMKVAQLAYQCLSQNPKGRPLMSQVVDILETL

HMMSmart: SM00219
IPR020635
8-285 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRPELILGEGGFGVVYKGVVDDTVRTGYKTTQVAIKELNREGYQGDREWLAEVNYLGQLSHPNLVKLIGYCCEDEHRLLVYEYMASGSLEKHLFRRVGCTLTWSRRMKIALDAAKGLAFLHGAERPIIYRDFKTSNILLDGDFNAKLSDFGLAKEGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLELLIGRRAMDKSRPSREHNLVEWARPLLNHNKKLLRIVDPRLEGQYSFKTAMKVAQLAYQCLSQNPKGRPLMSQVVDIL

PatternScan: PS00107
IPR017441
14-43 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGVVYKGVVDDTVRTGYKTTQVAIK

HMMPfam: PF07714
IPR001245
14-285 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

LGEGGFGVVYKGVVDDTVRTGYKTTQVAIKELNREGYQGDREWLAEVNYLGQLSHPNLVKLIGYCCEDEHRLLVYEYMASGSLEKHLFRRVGCTLTWSRRMKIALDAAKGLAFLHGAERPIIYRDFKTSNILLDGDFNAKLSDFGLAKEGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLELLIGRRAMDKSRPSREHNLVEWARPLLNHNKKLLRIVDPRLEGQYSFKTAMKVAQLAYQCLSQNPKGRPLMSQVVDIL

Gene3D: G3DSA:1.10.510.10
78-287 no description

CCEDEHRLLVYEYMASGSLEKHLFRRVGCTLTWSRRMKIALDAAKGLAFLHGAERPIIYRDFKTSNILLDGDFNAKLSDFGLAKEGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLELLIGRRAMDKSRPSREHNLVEWARPLLNHNKKLLRIVDPRLEGQYSFKTAMKVAQLAYQCLSQNPKGRPLMSQVVDILET

PatternScan: PS00108
IPR008271
134-146 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIYRDFKTSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox