PRGDB00172333 (ppa018380m)

From PRG Wiki
Jump to: navigation, search
ppa018380m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

S-locus lectin protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGAAGGGCCTTCCTTTCATCTTCACCTCTCTGCTCCAGTTCTTAGTCTTACAATTGGCCACAGCAGCTGATACGATATCCCCATCAAAACCCATCATAGGCTCTGATACCTTGGTTTCATCTGGGCAGAGCTTTAAATCAGGGCTTTTCTCTGCTGGTAATTCTTCTTGGTATTTGGGAATATGGTACAATAATTTTCCAGATGTTGTTGTCTGGGTAGCCAACAGAGAAAACCCACTTGCAGATTCGTATGGATCCTTGACACTCTCAAAAAATGGAAGTCTGGTCCTTTTGGATCAAATGAACAACTCTGTTTGGTCTTCCACTTCTTCCCAAGTAGCAGAAGATCCTGTTGCAGAGCTTTTGGAGACTGGAAACCTGGTTGTCAGAGACAAGGCCGCCACAGCTTCAGAAATCTACATATGGGAAAGTTTCGATTTCCCATCAGACACTCTGCTGCAAGACATGAAGTTGGGGTGGAACTTCAGGACAGGCCACAACAGATTCTTGACTTCTTGGAAAAATGATAGTGATCCATCTCCTGGACAATATACTTACGGGATGGATAATGTTCCGTTGCCTCAGCTTGTTATTGCCAAAGGAGCAAAGAAACAGTTTCGTACAGGACCATGGAACGGTCTTCGATTAACAGGTACTCCTGGTTCATCAGTTTCCTACGAAGTTGTGCACCCAATTTTTGTGTATAATACTACTGATTTATACTATTCATATGAGGCTGTTGATAAATCTGTTGTCACAAGATTGAAGCTGAGTGAATCGGGTATCCAGCGGCTAGTGGTCAACAAAGGAAGCACAACATGGGCTGTTATGTATACTTTGCAGTATAATCAGTGTGATAATTATGGAGTGTGTGGAGCAAATAGCATTTGTAAAATTAACAAATCACCTGTTTGTGAGTGCTTGCATGGGTTTGTCCCGGAATCATGGAACGAATGGGGGGTGCTTAATTGGACAAGTGGGTGCAGGAGGGGAACACCACTGAATTGCCAGAAGGGAGAAGACTTTCTGAGAATTCGAAATGTGAAACTGCCTGACCAGTTGGATTTTAGGGTGATCCTGAGCACTAGCATCGATGAATGCAAAGCAGAGTGCTTGAGGAATTGTTCTTGTGTAGCTTATACTAAATCAGATATCGGTAAGGGAGATAGTGGCTGTCTGATGTGGTCTGGCGCCTTAATTGATATGCGAGAGTTCGATGAAGATGATAGGGAGCAAGATATATATATTCGGATGCCATTTTCAGAACTAGGTAGGGCTGCTAAACGAAAGAAAAGAGCATCAAGAGACAGTAAGGAGGACTTGGAGTTGCCACTGTTTGATTTTGATACAATTGCAACCGCCACCAATAACTTCTCCCACACAAACAAACTAGGAGAGGGAGGTTTCGGTCCAGTTTACAAGGCCAACCTAACCCGAGAAGAATTCATAGCTGTAAAGAGACTCTCAAAAGATTCTGGGCAAGGTATTGAAGAGTTCAAGAATGAAGTTACAATGATAGCAAAACTTCAACACTGGAATCTTGTTAAACTTTTGGGCTGTTGCATCCAAGGAGAAGAAAGGATGCTTATCTATGAGTACATGCCCAACAAAAGCTTAGACTGCTTTATCTTCGATCAAAGTAAAAAGGCATTGCTTGATTGGCGAAAGCGATTTGACATCATCATGGGAATCGCACGAGGACTTCTCTACCTCCATGAAGACTCCAGATTAAGAATCATTCACAGGGACCTGAAGAGCAGCAACATCTTACTTGATGATGAGCTGAACCCCAAAATATCTGACTTTGGCATAGCTAGGATTTTTGGACGCAATCAAACTGAAGCAAAAACAAAACGAGTCATTGGGACATACGGATATATGTCTCCTGAGTATGCAATTGATGGGAAGTTTTCAATGAAATCCGATGTCTTCAGTTTTGGAGTGCTTTTGTTAGAGATTGTAAGTGGCAGAAAGAACAGGGGGTTTCATCATCCAGATCACCATCACACTCTTCTGGGACATGCATGGCTACTGTGGAACAAAAACAAAGGTTTGGAACTAATGGATTCATGTTTGGATAACTCATATGTGAAGTTTGATGTGCTAAGATGCATTCAAATTGGTCTATTATGTGTTCAAAAGCTATCCTTGGAAAGACCAGCAATGTCATCCGTGGTGTTCATGTTAGGCAACGAGGGAGCAATATTGCCTCAACCAAAGGAGCCTGGTTTCTTCACAGAAAGAAGTTCCACGGGTACGGATAACCTAATCAGCAACGGAACGATTACTATTTCGACGGTGGTGGCTAGATAG


Protein sequences

Name Description Sequence
ppa018380m S-locus lectin protein kinase family protein (best arabidopsis hit)

MKGLPFIFTSLLQFLVLQLATAADTISPSKPIIGSDTLVSSGQSFKSGLFSAGNSSWYLGIWYNNFPDVVVWVANRENPLADSYGSLTLSKNGSLVLLDQMNNSVWSSTSSQVAEDPVAELLETGNLVVRDKAATASEIYIWESFDFPSDTLLQDMKLGWNFRTGHNRFLTSWKNDSDPSPGQYTYGMDNVPLPQLVIAKGAKKQFRTGPWNGLRLTGTPGSSVSYEVVHPIFVYNTTDLYYSYEAVDKSVVTRLKLSESGIQRLVVNKGSTTWAVMYTLQYNQCDNYGVCGANSICKINKSPVCECLHGFVPESWNEWGVLNWTSGCRRGTPLNCQKGEDFLRIRNVKLPDQLDFRVILSTSIDECKAECLRNCSCVAYTKSDIGKGDSGCLMWSGALIDMREFDEDDREQDIYIRMPFSELGRAAKRKKRASRDSKEDLELPLFDFDTIATATNNFSHTNKLGEGGFGPVYKANLTREEFIAVKRLSKDSGQGIEEFKNEVTMIAKLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQSKKALLDWRKRFDIIMGIARGLLYLHEDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSMKSDVFSFGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNKNKGLELMDSCLDNSYVKFDVLRCIQIGLLCVQKLSLERPAMSSVVFMLGNEGAILPQPKEPGFFTERSSTGTDNLISNGTITISTVVAR*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF432
6-751 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

FIFTSLLQFLVLQLATAADTISPSKPIIGSDTLVSSGQSFKSGLFSAGNSSWYLGIWYNNFPDVVVWVANRENPLADSYGSLTLSKNGSLVLLDQMNNSVWSSTSSQVAEDPVAELLETGNLVVRDKAATASEIYIWESFDFPSDTLLQDMKLGWNFRTGHNRFLTSWKNDSDPSPGQYTYGMDNVPLPQLVIAKGAKKQFRTGPWNGLRLTGTPGSSVSYEVVHPIFVYNTTDLYYSYEAVDKSVVTRLKLSESGIQRLVVNKGSTTWAVMYTLQYNQCDNYGVCGANSICKINKSPVCECLHGFVPESWNEWGVLNWTSGCRRGTPLNCQKGEDFLRIRNVKLPDQLDFRVILSTSIDECKAECLRNCSCVAYTKSDIGKGDSGCLMWSGALIDMREFDEDDREQDIYIRMPFSELGRAAKRKKRASRDSKEDLELPLFDFDTIATATNNFSHTNKLGEGGFGPVYKANLTREEFIAVKRLSKDSGQGIEEFKNEVTMIAKLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQSKKALLDWRKRFDIIMGIARGLLYLHEDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSMKSDVFSFGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNKNKGLELMDSCLDNSYVKFDVLRCIQIGLLCVQKLSLERPAMSSVVFMLGNEGAILPQPKEPGFFTERSST

HMMPanther: PTHR24420
6-751 FAMILY NOT NAMED,FAMILY NOT NAMED

FIFTSLLQFLVLQLATAADTISPSKPIIGSDTLVSSGQSFKSGLFSAGNSSWYLGIWYNNFPDVVVWVANRENPLADSYGSLTLSKNGSLVLLDQMNNSVWSSTSSQVAEDPVAELLETGNLVVRDKAATASEIYIWESFDFPSDTLLQDMKLGWNFRTGHNRFLTSWKNDSDPSPGQYTYGMDNVPLPQLVIAKGAKKQFRTGPWNGLRLTGTPGSSVSYEVVHPIFVYNTTDLYYSYEAVDKSVVTRLKLSESGIQRLVVNKGSTTWAVMYTLQYNQCDNYGVCGANSICKINKSPVCECLHGFVPESWNEWGVLNWTSGCRRGTPLNCQKGEDFLRIRNVKLPDQLDFRVILSTSIDECKAECLRNCSCVAYTKSDIGKGDSGCLMWSGALIDMREFDEDDREQDIYIRMPFSELGRAAKRKKRASRDSKEDLELPLFDFDTIATATNNFSHTNKLGEGGFGPVYKANLTREEFIAVKRLSKDSGQGIEEFKNEVTMIAKLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQSKKALLDWRKRFDIIMGIARGLLYLHEDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSMKSDVFSFGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNKNKGLELMDSCLDNSYVKFDVLRCIQIGLLCVQKLSLERPAMSSVVFMLGNEGAILPQPKEPGFFTERSST

ProfileScan: PS50927
IPR001480
23-142 BULB_LECTIN
Bulb-type lectin domain

ADTISPSKPIIGSDTLVSSGQSFKSGLFSAGNSSWYLGIWYNNFPDVVVWVANRENPLADSYGSLTLSKNGSLVLLDQMNNSVWSSTSSQVAEDPVAELLETGNLVVRDKAATASEIYIW

HMMSmart: SM00108
IPR001480
29-148 Bulb-type mannose-specific lectin
Bulb-type lectin domain

SKPIIGSDTLVSSGQSFKSGLFSAGNSSWYLGIWYNNFPDVVVWVANRENPLADSYGSLTLSKNGSLVLLDQMNNSVWSSTSSQVAEDPVAELLETGNLVVRDKAATASEIYIWESFDFP

superfamily: SSF51110
IPR001480
59-179 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

LGIWYNNFPDVVVWVANRENPLADSYGSLTLSKNGSLVLLDQMNNSVWSSTSSQVAEDPVAELLETGNLVVRDKAATASEIYIWESFDFPSDTLLQDMKLGWNFRTGHNRFLTSWKNDSDP

HMMPfam: PF01453
IPR001480
69-180 B_lectin
Bulb-type lectin domain

VVVWVANRENPLADSYGSLTLSKNGSLVLLDQMNNSVWSSTSSQVAEDPVAELLETGNLVVRDKAATASEIYIWESFDFPSDTLLQDMKLGWNFRTGHNRFLTSWKNDSDPS

Gene3D: G3DSA:2.90.10.10
IPR001480
181-217 no description
Bulb-type lectin domain

PGQYTYGMDNVPLPQLVIAKGAKKQFRTGPWNGLRLT

HMMPfam: PF00954
IPR000858
206-314 S_locus_glycop
S-locus glycoprotein

FRTGPWNGLRLTGTPGSSVSYEVVHPIFVYNTTDLYYSYEAVDKSVVTRLKLSESGIQRLVVNKGSTTWAVMYTLQYNQCDNYGVCGANSICKINKSPVCECLHGFVPE

superfamily: SSF57414
335-422 Hairpin loop containing domain-like

NCQKGEDFLRIRNVKLPDQLDFRVILSTSIDECKAECLRNCSCVAYTKSDIGKGDSGCLMWSGALIDMREFDEDDREQDIYIRMPFSE

ProfileScan: PS50948
IPR003609
336-419 PAN
Apple-like

CQKGEDFLRIRNVKLPDQLDFRVILSTSIDECKAECLRNCSCVAYTKSDIGKGDSGCLMWSGALIDMREFDEDDREQDIYIRMP

HMMPfam: PF08276
IPR013227
336-402 PAN_2
PAN-2 domain

CQKGEDFLRIRNVKLPDQLDFRVILSTSIDECKAECLRNCSCVAYTKSDIGKGDSGCLMWSGALIDM

HMMSmart: SM00473
IPR003609
337-418 divergent subfamily of APPLE domains
Apple-like

QKGEDFLRIRNVKLPDQLDFRVILSTSIDECKAECLRNCSCVAYTKSDIGKGDSGCLMWSGALIDMREFDEDDREQDIYIRM

Seg: seg
425-433 seg

RAAKRKKRA

superfamily: SSF56112
IPR011009
428-729 Protein kinase-like (PK-like)
Protein kinase-like domain

KRKKRASRDSKEDLELPLFDFDTIATATNNFSHTNKLGEGGFGPVYKANLTREEFIAVKRLSKDSGQGIEEFKNEVTMIAKLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQSKKALLDWRKRFDIIMGIARGLLYLHEDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSMKSDVFSFGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNKNKGLELMDSCLDNSYVKFDVLRCIQIGLLCVQKLSLERPAMSSVVFML

Gene3D: G3DSA:3.30.200.20
442-519 no description

ELPLFDFDTIATATNNFSHTNKLGEGGFGPVYKANLTREEFIAVKRLSKDSGQGIEEFKNEVTMIAKLQHWNLVKLLG

HMMSmart: SM00220
IPR002290
458-705 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSHTNKLGEGGFGPVYKANLTREEFIAVKRLSKDSGQGIEEFKNEVTMIAKLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQSKKALLDWRKRFDIIMGIARGLLYLHEDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSMKSDVFSFGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNKNKGLELMDSCLDNSYVKFDVLRCI

ProfileScan: PS50011
IPR000719
458-710 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSHTNKLGEGGFGPVYKANLTREEFIAVKRLSKDSGQGIEEFKNEVTMIAKLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQSKKALLDWRKRFDIIMGIARGLLYLHEDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSMKSDVFSFGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNKNKGLELMDSCLDNSYVKFDVLRCIQIGLL

HMMSmart: SM00219
IPR020635
458-729 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSHTNKLGEGGFGPVYKANLTREEFIAVKRLSKDSGQGIEEFKNEVTMIAKLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQSKKALLDWRKRFDIIMGIARGLLYLHEDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSMKSDVFSFGVLLLEIVSGRKNRGFHHPDHHHTLLGHAWLLWNKNKGLELMDSCLDNSYVKFDVLRCIQIGLLCVQKLSLERPAMSSVVFML

HMMPfam: PF07714
IPR001245
461-658 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

TNKLGEGGFGPVYKANLTREEFIAVKRLSKDSGQGIEEFKNEVTMIAKLQHWNLVKLLGCCIQGEERMLIYEYMPNKSLDCFIFDQSKKALLDWRKRFDIIMGIARGLLYLHEDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSMKSDVFSFGVLLLEIVSGRK

Gene3D: G3DSA:1.10.510.10
520-659 no description

CCIQGEERMLIYEYMPNKSLDCFIFDQSKKALLDWRKRFDIIMGIARGLLYLHEDSRLRIIHRDLKSSNILLDDELNPKISDFGIARIFGRNQTEAKTKRVIGTYGYMSPEYAIDGKFSMKSDVFSFGVLLLEIVSGRKN

PatternScan: PS00108
IPR008271
579-591 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKSSNILL

Seg: seg
663-674 seg

HHPDHHHTLLGH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox