PRGDB00172359 (ppa022551m)

From PRG Wiki
Jump to: navigation, search
ppa022551m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class NL
Domain Type NBS, LRR
Gene Species Prunus persica

Comment?

disease resistance protein (TIR-NBS-LRR class), putative (best arabidopsis hit)

DNA Sequence

TTGGAATTGTCCAAGGATTTTGTAAATTATGCCAGAGGACTTCCACTAGCTCTTAAACTTTTGGGATGCTTAGTGTATAAGAGAGATCCAGATGAATGGAAAAGTGAATTGGATAAGCTGCGGATAATTCCTAAGTCAGAAATTATTGATTTGCTCAAAATAATTTATGATGGACTAGATGAGATGAATAAGGATATATTTCTTGATGTTGCATGTTTCCATAAAGGGAAGAGCAAGGAGGAAGTAATTGAAATGCTACACAATTGTGGCCTATGCGGTCATATTGGGATAAATGATCTCGTTCAGAAATCGCTCTTAACTATATCAAATGAGAATGTTGAGATGCATAATTTGATACAAGAAATGACATTGGAAATTGTTCGTCGAGAGTGTCTTGAAGAGCCTGTATTAGACTTAATTAATGATATCTTTGATGCAACGGACAAAATTAGAGGCATCAGCTTACACATGGCGACAGTTGAAAAGAAAAATTGGAATTGTGAAGCCTTCTCTAAGATGCTTAACCTGAAATTTCTTGAATTTGATAATATGATGATTTCTTCAAGCCCTAGAATTCTTCCTAATTCCTTGAGAAGTATCAAATGGAGTCGGTATCCTTCCAAATTTCTCCCATCAGGCTTTCAACCGAATTTCCTTATTTCACTTGAGATGCCTAATAGCAAACTTGTTCGGCTTTGGGATGGAAGAAAGGACTTGCCCTACTTGAAAAAAATGAGCCTACTTGCCTCTAAAAAGTTGACCACAACCCCAGATTTCAGTGGCATGCGGAATCTTGAGGTGTTGGATTTTCAATTTTGGGATAATTTGGTTGAGATTCACCCGTCAATTGCAGATCTCAAATGTCTTAAATGGTTGCTTTTTGGTTTTTGCCCAAAATTGAAAAAGATTCCAGAATTTTTAGGGCAAATGAAAAATTTGTCATCGCTTTGTTTATTTGGGACTTCCATTGAGAAATTATCTTTATCAATAGGACGTCTGGTTGGCCTTAGTAGTCTGTCACTACTGTATTGCAAAAATCTTGTGGATCTTCTGAGTGAAATTTGTAATTTGAAGTTTCTTACAGCGCTCGGGGTGGGTGGATGCCCAAAAATTGACAAACTCCCAGAGAACGTGGGAGAGATGGAGTGTTTAGAGATGCTTCGATTGGATGGAACTTCTATAAGACAGCTGCCACACTCCGTTGTTGAGGATCTTCCCAGCGATATTGGCTGTTTGTCCTCTTTAGAAGAATTAAAGCTTAGTGGAAACAATTTTGTTAGCCTTCCTGCAAGCATTGGATGTCTTTCTAAGCTTACGTTATTTTGGGTGAATGAGTGCCAAAGGCTTCAACAATTGCCAGATCTTTCTAAGCTTATCTCGTTAGTGGATATAGACATAACCAGTTGCACTTCCTTAAAAATAGTTTGGGGCCGTGACTTGTATTTTTGGGTAGGTCGTACTGAGACGAGTTCATAG


Protein sequences

Name Description Sequence
ppa022551m disease resistance protein (TIR-NBS-LRR class), putative (best arabidopsis hit)

LELSKDFVNYARGLPLALKLLGCLVYKRDPDEWKSELDKLRIIPKSEIIDLLKIIYDGLDEMNKDIFLDVACFHKGKSKEEVIEMLHNCGLCGHIGINDLVQKSLLTISNENVEMHNLIQEMTLEIVRRECLEEPVLDLINDIFDATDKIRGISLHMATVEKKNWNCEAFSKMLNLKFLEFDNMMISSSPRILPNSLRSIKWSRYPSKFLPSGFQPNFLISLEMPNSKLVRLWDGRKDLPYLKKMSLLASKKLTTTPDFSGMRNLEVLDFQFWDNLVEIHPSIADLKCLKWLLFGFCPKLKKIPEFLGQMKNLSSLCLFGTSIEKLSLSIGRLVGLSSLSLLYCKNLVDLLSEICNLKFLTALGVGGCPKIDKLPENVGEMECLEMLRLDGTSIRQLPHSVVEDLPSDIGCLSSLEELKLSGNNFVSLPASIGCLSKLTLFWVNECQRLQQLPDLSKLISLVDIDITSCTSLKIVWGRDLYFWVGRTETSS*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
2-475 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ELSKDFVNYARGLPLALKLLGCLVYKRDPDEWKSELDKLRIIPKSEIIDLLKIIYDGLDEMNKDIFLDVACFHKGKSKEEVIEMLHNCGLCGHIGINDLVQKSLLTISNENVEMHNLIQEMTLEIVRRECLEEPVLDLINDIFDATDKIRGISLHMATVEKKNWNCEAFSKMLNLKFLEFDNMMISSSPRILPNSLRSIKWSRYPSKFLPSGFQPNFLISLEMPNSKLVRLWDGRKDLPYLKKMSLLASKKLTTTPDFSGMRNLEVLDFQFWDNLVEIHPSIADLKCLKWLLFGFCPKLKKIPEFLGQMKNLSSLCLFGTSIEKLSLSIGRLVGLSSLSLLYCKNLVDLLSEICNLKFLTALGVGGCPKIDKLPENVGEMECLEMLRLDGTSIRQLPHSVVEDLPSDIGCLSSLEELKLSGNNFVSLPASIGCLSKLTLFWVNECQRLQQLPDLSKLISLVDIDITSCTSLKIV

HMMPfam: PF00931
IPR002182
2-91 NB-ARC,NBS
NB-ARC

ELSKDFVNYARGLPLALKLLGCLVYKRDPDEWKSELDKLRIIPKSEIIDLLKIIYDGLDEMNKDIFLDVACFHKGKSKEEVIEMLHNCGL

HMMPanther: PTHR11017
2-475 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ELSKDFVNYARGLPLALKLLGCLVYKRDPDEWKSELDKLRIIPKSEIIDLLKIIYDGLDEMNKDIFLDVACFHKGKSKEEVIEMLHNCGLCGHIGINDLVQKSLLTISNENVEMHNLIQEMTLEIVRRECLEEPVLDLINDIFDATDKIRGISLHMATVEKKNWNCEAFSKMLNLKFLEFDNMMISSSPRILPNSLRSIKWSRYPSKFLPSGFQPNFLISLEMPNSKLVRLWDGRKDLPYLKKMSLLASKKLTTTPDFSGMRNLEVLDFQFWDNLVEIHPSIADLKCLKWLLFGFCPKLKKIPEFLGQMKNLSSLCLFGTSIEKLSLSIGRLVGLSSLSLLYCKNLVDLLSEICNLKFLTALGVGGCPKIDKLPENVGEMECLEMLRLDGTSIRQLPHSVVEDLPSDIGCLSSLEELKLSGNNFVSLPASIGCLSKLTLFWVNECQRLQQLPDLSKLISLVDIDITSCTSLKIV

Seg: seg
14-24 seg

LPLALKLLGCL

superfamily: SSF52058
117-488 L domain-like,LRR

NLIQEMTLEIVRRECLEEPVLDLINDIFDATDKIRGISLHMATVEKKNWNCEAFSKMLNLKFLEFDNMMISSSPRILPNSLRSIKWSRYPSKFLPSGFQPNFLISLEMPNSKLVRLWDGRKDLPYLKKMSLLASKKLTTTPDFSGMRNLEVLDFQFWDNLVEIHPSIADLKCLKWLLFGFCPKLKKIPEFLGQMKNLSSLCLFGTSIEKLSLSIGRLVGLSSLSLLYCKNLVDLLSEICNLKFLTALGVGGCPKIDKLPENVGEMECLEMLRLDGTSIRQLPHSVVEDLPSDIGCLSSLEELKLSGNNFVSLPASIGCLSKLTLFWVNECQRLQQLPDLSKLISLVDIDITSCTSLKIVWGRDLYFWVGRTE

Gene3D: G3DSA:3.80.10.10
160-467 no description

VEKKNWNCEAFSKMLNLKFLEFDNMMISSSPRILPNSLRSIKWSRYPSKFLPSGFQPNFLISLEMPNSKLVRLWDGRKDLPYLKKMSLLASKKLTTTPDFSGMRNLEVLDFQFWDNLVEIHPSIADLKCLKWLLFGFCPKLKKIPEFLGQMKNLSSLCLFGTSIEKLSLSIGRLVGLSSLSLLYCKNLVDLLSEICNLKFLTALGVGGCPKIDKLPENVGEMECLEMLRLDGTSIRQLPHSVVEDLPSDIGCLSSLEELKLSGNNFVSLPASIGCLSKLTLFWVNECQRLQQLPDLSKLISLVDIDIT

Seg: seg
242-256 seg

LKKMSLLASKKLTTT

ProfileScan: PS51450
IPR001611
322-343 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIEKLSLSIGRLVGLSSLSLLY

Seg: seg
326-342 seg

LSLSIGRLVGLSSLSLL

HMMSmart: SM00369
IPR003591
381-404 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MECLEMLRLDGTSIRQLPHSVVED

HMMSmart: SM00369
IPR003591
412-435 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLEELKLSGNNFVSLPASIGCL

ProfileScan: PS51450
IPR001611
414-435 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEELKLSGNNFVSLPASIGCL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox