PRGDB00172361 (ppa002823m)

From PRG Wiki
Jump to: navigation, search
ppa002823m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGACAAGAAAGTAGAGCTTTTGTTCGTTTTGTTGATTGGAACCATTTTCTTGCATGCCACTGCGGACCCAGTTGAAGATAAGCAAGCTTTGCTAGATTTCCTTCACAATATTTCTCACTCAAACTCTATCAAATGGAATGATAACTCTTCTGTGTGCAAAAACTGGACTGGAGTGATTTGTAGCGAAGACCAGTCCAGAATAATAGAGCTCCATTTGCCTGGAGCTGCTTTACATGGTCCAATCCCACCCAACACTCTCAGCCGCCTATCTGCCCTTCAGGTTCTCAGTCTCAGGTTGAATAGTTTAACAGGTCCATTCCCTTCTGATTTTTCTAAACTTGAAAACTTAACCTCCCTTTATCTTCAATTCAACAACTTCTCCGGCCCATTGCCTTTAGATTTTTCACCTTGGAAGAATCTTACTGTCATGAATCTCTCAAACAATGCATTTAGTGGGAAAATCCCTTCCTCAATTTCAAGTTTGACTCACCTCACAGTTCTGAATCTTGCCAACAATTCGCTTTCGGGTGAAATTCCTGATCTCAATCTTCCTAGTTTGCAACAGCTTGATTTAGCTAACAATAATCTCACAGGGAATGTGCCTCAGTCTCTCCAAAGATTTCCAGGTTGGGCCTTTTCAGGTAACGGTCTTTCATCACAATGGGCCCTTCCTCCAGCTCTTCCAGTTCAACCACCTAATGCTCAACCAAGAAAAAAAACAAACCTTGGTGAACCTGCAATACTAGGTATTGTGATTGGTGGATGTGTTCTGGGGTTTGTTGTAATTGCTATTGTGATGATTATTTGCTGCACCAATAAAGAAGGTGAAAATGGGCCAGTTGAAAAACCACAGAAGAAGAAAGAAATCTTTTCAAATAAAGGAGTTTCTGAGAAACATGACAAGAATAATAGGCTTTCCTTCTTTGAGGGTTCTAATCTTGCATTTGATCTGGAGGACTTGCTGAGGGCATCTGCTGAGGTGCTTGGTAAAGGAACCTTTGGGACAACATACAAGGCTGCTTTGGAAGATGCAACTACTGTTGTGGTGAAGAGGTTGAAGGAAGTGAGTGTTGGAAAGAAGGAATTTGAGCAGCAAATGGAGATTGTAGGAAGTATCAGGCATGAGAATATAGCTGCTCTAAGGGCATATTACTATTCCAAGGATGAGAAGCTTGTTGTGTATGATTATTATGAGCAGGGGAGTGCCTCTTCATTGTTACACGCTAAAAGAGGAGAGGGCAGGACGCCACTAGACTGGGAGACTCGACTAAGAATAGCAATTGGTGCAGCCAGAGGCATTGCTCATATCCACACACAGAATGGTGGAAAACTTGTCCATGGAAACATAAAGGCCTCAAACATTTTCCTCAACTCTCAAGGATATGGTTGTGTGTGTGACATTGGTTTGGCAACACTGATGAGCCCAATGCCCCCGCCCGCAGCGCGTGCTGGTGGATACAGATCCCCAGAAGTGACAGACACTCGAAAGTCTTCCCATGCATCCGATGTCTACAGTTTCGGGGTCCTGATACTTGAGCTCCTCACTGGAAAAAGCCCCATACACACAACAGGTGGTGAAGAAGTTATCCACTTGGTAAGGTGGGTGAACTCTGTGGTCAGGGAGGAATGGACAGCAGAAGTGTTTGATGTAGAGCTCTTGAGGTATCCAAACATAGAGGAGGAAATGGTAGAGATGTTGCAAATAGGAATGTCTTGCGTGGCTAGAATGCCGGAGCAACGACCAAGCATGCCGGATGTGGTTAAAAGGGTGGAGGAAATTCGTCAAGTCAACACTGGAAATCCACCATCCTCATCAGGAATATCTACCCCAGTCTTAACACCTCCACCTCCTACGGCCGAGATAGGATCCTCCTCTCAGCCACAGTGA


Protein sequences

Name Description Sequence
ppa002823m Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

MDKKVELLFVLLIGTIFLHATADPVEDKQALLDFLHNISHSNSIKWNDNSSVCKNWTGVICSEDQSRIIELHLPGAALHGPIPPNTLSRLSALQVLSLRLNSLTGPFPSDFSKLENLTSLYLQFNNFSGPLPLDFSPWKNLTVMNLSNNAFSGKIPSSISSLTHLTVLNLANNSLSGEIPDLNLPSLQQLDLANNNLTGNVPQSLQRFPGWAFSGNGLSSQWALPPALPVQPPNAQPRKKTNLGEPAILGIVIGGCVLGFVVIAIVMIICCTNKEGENGPVEKPQKKKEIFSNKGVSEKHDKNNRLSFFEGSNLAFDLEDLLRASAEVLGKGTFGTTYKAALEDATTVVVKRLKEVSVGKKEFEQQMEIVGSIRHENIAALRAYYYSKDEKLVVYDYYEQGSASSLLHAKRGEGRTPLDWETRLRIAIGAARGIAHIHTQNGGKLVHGNIKASNIFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVKRVEEIRQVNTGNPPSSSGISTPVLTPPPPTAEIGSSSQPQ*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
7-605 FAMILY NOT NAMED,FAMILY NOT NAMED

LLFVLLIGTIFLHATADPVEDKQALLDFLHNISHSNSIKWNDNSSVCKNWTGVICSEDQSRIIELHLPGAALHGPIPPNTLSRLSALQVLSLRLNSLTGPFPSDFSKLENLTSLYLQFNNFSGPLPLDFSPWKNLTVMNLSNNAFSGKIPSSISSLTHLTVLNLANNSLSGEIPDLNLPSLQQLDLANNNLTGNVPQSLQRFPGWAFSGNGLSSQWALPPALPVQPPNAQPRKKTNLGEPAILGIVIGGCVLGFVVIAIVMIICCTNKEGENGPVEKPQKKKEIFSNKGVSEKHDKNNRLSFFEGSNLAFDLEDLLRASAEVLGKGTFGTTYKAALEDATTVVVKRLKEVSVGKKEFEQQMEIVGSIRHENIAALRAYYYSKDEKLVVYDYYEQGSASSLLHAKRGEGRTPLDWETRLRIAIGAARGIAHIHTQNGGKLVHGNIKASNIFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVKRVEEIRQVNTGNPPSS

HMMPanther: PTHR24420:SF850
7-605 SUBFAMILY NOT NAMED

LLFVLLIGTIFLHATADPVEDKQALLDFLHNISHSNSIKWNDNSSVCKNWTGVICSEDQSRIIELHLPGAALHGPIPPNTLSRLSALQVLSLRLNSLTGPFPSDFSKLENLTSLYLQFNNFSGPLPLDFSPWKNLTVMNLSNNAFSGKIPSSISSLTHLTVLNLANNSLSGEIPDLNLPSLQQLDLANNNLTGNVPQSLQRFPGWAFSGNGLSSQWALPPALPVQPPNAQPRKKTNLGEPAILGIVIGGCVLGFVVIAIVMIICCTNKEGENGPVEKPQKKKEIFSNKGVSEKHDKNNRLSFFEGSNLAFDLEDLLRASAEVLGKGTFGTTYKAALEDATTVVVKRLKEVSVGKKEFEQQMEIVGSIRHENIAALRAYYYSKDEKLVVYDYYEQGSASSLLHAKRGEGRTPLDWETRLRIAIGAARGIAHIHTQNGGKLVHGNIKASNIFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVKRVEEIRQVNTGNPPSS

superfamily: SSF52058
21-208 L domain-like,LRR

TADPVEDKQALLDFLHNISHSNSIKWNDNSSVCKNWTGVICSEDQSRIIELHLPGAALHGPIPPNTLSRLSALQVLSLRLNSLTGPFPSDFSKLENLTSLYLQFNNFSGPLPLDFSPWKNLTVMNLSNNAFSGKIPSSISSLTHLTVLNLANNSLSGEIPDLNLPSLQQLDLANNNLTGNVPQSLQRF

HMMPfam: PF08263
IPR013210
26-62 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EDKQALLDFLHNISHSNSIKWNDNSSVCKNWTGVICS

Gene3D: G3DSA:3.80.10.10
29-208 no description

QALLDFLHNISHSNSIKWNDNSSVCKNWTGVICSEDQSRIIELHLPGAALHGPIPPNTLSRLSALQVLSLRLNSLTGPFPSDFSKLENLTSLYLQFNNFSGPLPLDFSPWKNLTVMNLSNNAFSGKIPSSISSLTHLTVLNLANNSLSGEIPDLNLPSLQQLDLANNNLTGNVPQSLQRF

HMMPfam: PF13855
81-127 LRR_8,Leucine rich repeat

PIPPNTLSRLSALQVLSLRLNSLTGPFPSDFSKLENLTSLYLQFNNF

ProfileScan: PS51450
IPR001611
92-113 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALQVLSLRLNSLTGPFPSDFSK

ProfileScan: PS51450
IPR001611
116-137 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTSLYLQFNNFSGPLPLDFSP

HMMPfam: PF13855
140-197 LRR_8,Leucine rich repeat

NLTVMNLSNNAFSGKIPSSISSLTHLTVLNLANNSLSGEIPDLNLPSLQQLDLANNNL

ProfileScan: PS51450
IPR001611
140-162 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTVMNLSNNAFSGKIPSSISSL

ProfileScan: PS51450
IPR001611
164-186 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLTVLNLANNSLSGEIPDLNLPS

ProfileScan: PS51450
IPR001611
187-207 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LQQLDLANNNLTGNVPQSLQR

Seg: seg
248-263 seg

ILGIVIGGCVLGFVVI

superfamily: SSF56112
IPR011009
291-599 Protein kinase-like (PK-like)
Protein kinase-like domain

FSNKGVSEKHDKNNRLSFFEGSNLAFDLEDLLRASAEVLGKGTFGTTYKAALEDATTVVVKRLKEVSVGKKEFEQQMEIVGSIRHENIAALRAYYYSKDEKLVVYDYYEQGSASSLLHAKRGEGRTPLDWETRLRIAIGAARGIAHIHTQNGGKLVHGNIKASNIFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVKRVEEIRQVNT

Gene3D: G3DSA:3.30.200.20
309-383 no description

FEGSNLAFDLEDLLRASAEVLGKGTFGTTYKAALEDATTVVVKRLKEVSVGKKEFEQQMEIVGSIRHENIAALRA

HMMSmart: SM00220
IPR002290
323-597 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RASAEVLGKGTFGTTYKAALEDATTVVVKRLKEVSVGKKEFEQQMEIVGSIRHENIAALRAYYYSKDEKLVVYDYYEQGSASSLLHAKRGEGRTPLDWETRLRIAIGAARGIAHIHTQNGGKLVHGNIKASNIFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVKRVEEIRQV

ProfileScan: PS50011
IPR000719
323-594 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RASAEVLGKGTFGTTYKAALEDATTVVVKRLKEVSVGKKEFEQQMEIVGSIRHENIAALRAYYYSKDEKLVVYDYYEQGSASSLLHAKRGEGRTPLDWETRLRIAIGAARGIAHIHTQNGGKLVHGNIKASNIFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVKRVEEI

HMMSmart: SM00219
IPR020635
323-591 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RASAEVLGKGTFGTTYKAALEDATTVVVKRLKEVSVGKKEFEQQMEIVGSIRHENIAALRAYYYSKDEKLVVYDYYEQGSASSLLHAKRGEGRTPLDWETRLRIAIGAARGIAHIHTQNGGKLVHGNIKASNIFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVKRV

HMMPfam: PF00069
IPR000719
327-589 Pkinase,Ser-thr
Protein kinase, catalytic domain

EVLGKGTFGTTYKAALEDATTVVVKRLKEVSVGKKEFEQQMEIVGSIRHENIAALRAYYYSKDEKLVVYDYYEQGSASSLLHAKRGEGRTPLDWETRLRIAIGAARGIAHIHTQNGGKLVHGNIKASNIFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVK

PatternScan: PS00107
IPR017441
329-360 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGTFGTTYKAALEDATTVVVKRLKEVSVGK

Gene3D: G3DSA:1.10.510.10
384-589 no description

YYYSKDEKLVVYDYYEQGSASSLLHAKRGEGRTPLDWETRLRIAIGAARGIAHIHTQNGGKLVHGNIKASNIFLNSQGYGCVCDIGLATLMSPMPPPAARAGGYRSPEVTDTRKSSHASDVYSFGVLILELLTGKSPIHTTGGEEVIHLVRWVNSVVREEWTAEVFDVELLRYPNIEEEMVEMLQIGMSCVARMPEQRPSMPDVVK

Seg: seg
425-438 seg

RIAIGAARGIAHIH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox