PRGDB00172367 (ppa023082m)

From PRG Wiki
Jump to: navigation, search
ppa023082m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat (LRR) family protein (best arabidopsis hit)

DNA Sequence

CCAGCACAATTATCTTCCTTACTCCCCCCATTACCTCCACTACCACTAATCCCCGCATTACCTCCAATTATCCCCGAGCTTTTGAACTTCACAGACCAAAGACTAGCTCTGGTGTACCCTATAATAAACGCCTTCAAGAACACCATCACTTCAGACCCTTTAGGCATCACTCAAACCTGGGTTGGCTCGGATATATGCACCTACAAAGGCTTCTACTGTGATCGCCCACCAGACAATCAAAGCGCCTTTGCTCTCGCCTCCATCGATTTCAATGGCTTCCAACTCAGTGCTCCCAGTATCGACGGCTTCATCGACCAACTTCCTGACCTTGCACTCTTCCATGCAAACTCGAACAACTTTTCAGGTATCATTTCTCCAAAGATTGCAAATCTCAAATATCTCTACGAGCTTGACATAAGCAACAACAACTTCTTTGGCCCTTTCCCCACGGCTGTTCTCACCATGAATAACCTATCATTTTTGGACATTCGTTTCAACTCTTTTACTGGGTCTGTACCACCACAAATTTTCAAGAAAACCCTAGACGTCCTCTTCATTAACAACAACAAATTCATACAAAAACTTCCAGACAACCTTGGAGCTACACCAGCCCGTTATCTCACTTTAGCCAACAACAAATTCACCGGGCCAATCCCAAAAAGCATTGGCAGCGCTTCATCAACTTTGATAGAAGCTCTACTCATGAATAATTTGATAACGGGTTGCATCCCTTATGAACTAGGGTTTCTAAAAGATGCAACACTGTTTGATGCTGGAAACAACCAATTGACCGGCCCGTTGCCGTGTTCATTGGGATGCTTGGAGAAGATTGAGCAGCTTAATTTCGCCGGAAACTTCCTCTATGGAAAGGTGCCTGAGGTGGTGTGTGAATTAGGGAACTTGGCCAATTTATCGTTGTCTAACAACTATTTTACGATGGTTGGGCCAATTTGTAGGAAGCTGATTAAAAGTGGGGTTCTTGACTTGAGGAAGAACTGCATTCGTGATCTTGCAGATCAAAGATCAGTGGAGGAATGTGCCTCGAAAAGAAAAGGAAAAGAGCAAAGCCCAAAACGAGGGGAAAAGGACAAGGCTCAGGACACTCTGCAAAGGGTCCAAGAAAAGGCACCAAGGCCGAAGACCAACCGATATGCACCAACAAGAAGCCTAACAAGACATCAAGGAAATCAAGCCTAA


Protein sequences

Name Description Sequence
ppa023082m Leucine-rich repeat (LRR) family protein (best arabidopsis hit)

PAQLSSLLPPLPPLPLIPALPPIIPELLNFTDQRLALVYPIINAFKNTITSDPLGITQTWVGSDICTYKGFYCDRPPDNQSAFALASIDFNGFQLSAPSIDGFIDQLPDLALFHANSNNFSGIISPKIANLKYLYELDISNNNFFGPFPTAVLTMNNLSFLDIRFNSFTGSVPPQIFKKTLDVLFINNNKFIQKLPDNLGATPARYLTLANNKFTGPIPKSIGSASSTLIEALLMNNLITGCIPYELGFLKDATLFDAGNNQLTGPLPCSLGCLEKIEQLNFAGNFLYGKVPEVVCELGNLANLSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRDLADQRSVEECASKRKGKEQSPKRGEKDKAQDTLQRVQEKAPRPKTNRYAPTRSLTRHQGNQA*


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-341 FAMILY NOT NAMED,FAMILY NOT NAMED

PAQLSSLLPPLPPLPLIPALPPIIPELLNFTDQRLALVYPIINAFKNTITSDPLGITQTWVGSDICTYKGFYCDRPPDNQSAFALASIDFNGFQLSAPSIDGFIDQLPDLALFHANSNNFSGIISPKIANLKYLYELDISNNNFFGPFPTAVLTMNNLSFLDIRFNSFTGSVPPQIFKKTLDVLFINNNKFIQKLPDNLGATPARYLTLANNKFTGPIPKSIGSASSTLIEALLMNNLITGCIPYELGFLKDATLFDAGNNQLTGPLPCSLGCLEKIEQLNFAGNFLYGKVPEVVCELGNLANLSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRDLADQR

HMMPanther: PTHR24420:SF937
1-341 SUBFAMILY NOT NAMED

PAQLSSLLPPLPPLPLIPALPPIIPELLNFTDQRLALVYPIINAFKNTITSDPLGITQTWVGSDICTYKGFYCDRPPDNQSAFALASIDFNGFQLSAPSIDGFIDQLPDLALFHANSNNFSGIISPKIANLKYLYELDISNNNFFGPFPTAVLTMNNLSFLDIRFNSFTGSVPPQIFKKTLDVLFINNNKFIQKLPDNLGATPARYLTLANNKFTGPIPKSIGSASSTLIEALLMNNLITGCIPYELGFLKDATLFDAGNNQLTGPLPCSLGCLEKIEQLNFAGNFLYGKVPEVVCELGNLANLSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRDLADQR

Seg: seg
4-28 seg

LSSLLPPLPPLPLIPALPPIIPELL

superfamily: SSF52058
32-344 L domain-like,LRR

DQRLALVYPIINAFKNTITSDPLGITQTWVGSDICTYKGFYCDRPPDNQSAFALASIDFNGFQLSAPSIDGFIDQLPDLALFHANSNNFSGIISPKIANLKYLYELDISNNNFFGPFPTAVLTMNNLSFLDIRFNSFTGSVPPQIFKKTLDVLFINNNKFIQKLPDNLGATPARYLTLANNKFTGPIPKSIGSASSTLIEALLMNNLITGCIPYELGFLKDATLFDAGNNQLTGPLPCSLGCLEKIEQLNFAGNFLYGKVPEVVCELGNLANLSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRDLADQRSVE

Gene3D: G3DSA:3.80.10.10
43-335 no description

NAFKNTITSDPLGITQTWVGSDICTYKGFYCDRPPDNQSAFALASIDFNGFQLSAPSIDGFIDQLPDLALFHANSNNFSGIISPKIANLKYLYELDISNNNFFGPFPTAVLTMNNLSFLDIRFNSFTGSVPPQIFKKTLDVLFINNNKFIQKLPDNLGATPARYLTLANNKFTGPIPKSIGSASSTLIEALLMNNLITGCIPYELGFLKDATLFDAGNNQLTGPLPCSLGCLEKIEQLNFAGNFLYGKVPEVVCELGNLANLSLSNNYFTMVGPICRKLIKSGVLDLRKNCIR

HMMPfam: PF00560
IPR001611
157-178 LRR_1
Leucine-rich repeat

NLSFLDIRFNSFTGSVPPQIFK

Seg: seg
298-309 seg

LGNLANLSLSNN

HMMPfam: PF13504
299-312 LRR_7,Leucine rich repeat

GNLANLSLSNNYFT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox