PRGDB00172377 (ppa015104m)

From PRG Wiki
Jump to: navigation, search
ppa015104m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR
Gene Species Prunus persica

Comment?

NB-ARC domain-containing disease resistance protein (best arabidopsis hit)

DNA Sequence

ATGGCTGAAGCTCTGGTTTCCGTATTGCTAGAACAGTTGGCTTCCATCACCCTGCAGCAGATAGAGGAAGAGGTGAGGCTGGTCGTCGGCGTCGACCAAGAAGTCGAAAATCTCATCGGCCATCTCCAGGCAGTTCAAGGCGTGCTCCAGGATGCAGAGGAGAGGCAAGTGAAGGAGGCCAACGTCAAGAATTGGCTGTACAATCTGAAAGACGTGTCGTACCAGATAAACGACGTGTTGGATGAGTGGAACACCGCCATTCTCAAGCATCACATGGAGAAGCAAGAAAAAGAAGGTGAGAATAATGATCTTGTCCTTGCTATAAGAAATATTCTTATCTGTTTTGGTCAAATTGGTGATCGCATAATTATGCGTCATGACATTGCTAAGAGGATAAAAGAAATCAATGAAAGGCTAACTTGGATAGCCATTTCAAGAAACAATTATAACTTTCAAAGCACAGTAAGAGGCGCCGAACAAGTTGAACGATCCAAAACCACTTCCTTTGTCGACGTGTCTACCATAATTGGTCGTGAAGAGGAAAAAAATAAAGTACTTAGCATGTTGAAAAGTGAGAGTGGTGATCAATTGGTGATCCCCATTGTAGGGATGGGAGGGTTGGGCAAGACTGCTTTTGCCCAATCTGTGTACAATGACCAAAATGTAACAACTCATTTCCACAAGAGAATATGGGTTTGTGTGTCGGACCCTTTTGAAGAGATTAAGATTGCCAAAGCCATCATTGAAGTTCTGAATAAAGACGATACTCGAAAGAACTCAAATGAGTTTCATGCTAAAATATGA


Protein sequences

Name Description Sequence
ppa015104m NB-ARC domain-containing disease resistance protein (best arabidopsis hit)

MAEALVSVLLEQLASITLQQIEEEVRLVVGVDQEVENLIGHLQAVQGVLQDAEERQVKEANVKNWLYNLKDVSYQINDVLDEWNTAILKHHMEKQEKEGENNDLVLAIRNILICFGQIGDRIIMRHDIAKRIKEINERLTWIAISRNNYNFQSTVRGAEQVERSKTTSFVDVSTIIGREEEKNKVLSMLKSESGDQLVIPIVGMGGLGKTAFAQSVYNDQNVTTHFHKRIWVCVSDPFEEIKIAKAIIEVLNKDDTRKNSNEFHAKI*


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
2-265 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEALVSVLLEQLASITLQQIEEEVRLVVGVDQEVENLIGHLQAVQGVLQDAEERQVKEANVKNWLYNLKDVSYQINDVLDEWNTAILKHHMEKQEKEGENNDLVLAIRNILICFGQIGDRIIMRHDIAKRIKEINERLTWIAISRNNYNFQSTVRGAEQVERSKTTSFVDVSTIIGREEEKNKVLSMLKSESGDQLVIPIVGMGGLGKTAFAQSVYNDQNVTTHFHKRIWVCVSDPFEEIKIAKAIIEVLNKDDTRKNSNEFHA

HMMPanther: PTHR23155:SF121
2-265 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

AEALVSVLLEQLASITLQQIEEEVRLVVGVDQEVENLIGHLQAVQGVLQDAEERQVKEANVKNWLYNLKDVSYQINDVLDEWNTAILKHHMEKQEKEGENNDLVLAIRNILICFGQIGDRIIMRHDIAKRIKEINERLTWIAISRNNYNFQSTVRGAEQVERSKTTSFVDVSTIIGREEEKNKVLSMLKSESGDQLVIPIVGMGGLGKTAFAQSVYNDQNVTTHFHKRIWVCVSDPFEEIKIAKAIIEVLNKDDTRKNSNEFHA

Coil: coil
35-56 coiled-coil

VENLIGHLQAVQGVLQDAEERQ

superfamily: SSF52540
158-262 P-loop containing nucleoside triphosphate hydrolases

AEQVERSKTTSFVDVSTIIGREEEKNKVLSMLKSESGDQLVIPIVGMGGLGKTAFAQSVYNDQNVTTHFHKRIWVCVSDPFEEIKIAKAIIEVLNKDDTRKNSNE

HMMPfam: PF00931
IPR002182
178-262 NB-ARC,NBS
NB-ARC

REEEKNKVLSMLKSESGDQLVIPIVGMGGLGKTAFAQSVYNDQNVTTHFHKRIWVCVSDPFEEIKIAKAIIEVLNKDDTRKNSNE

Seg: seg
239-249 seg

EEIKIAKAIIE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox