PRGDB00172389 (ppa017466m)

From PRG Wiki
Jump to: navigation, search
ppa017466m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class N
Domain Type NBS
Gene Species Prunus persica

Comment?

ABC-2 type transporter family protein (best arabidopsis hit)

DNA Sequence

ATGGAGAAAGAAATGTTGGATATAGATATTCAAACTGCTACTGAAGCTCCAACTATCTTCAAGGAAGCCATTCGACCCGTCACATTGAAGTTTGAAGACGTGGTTTACAAGATCAAACAGAATAATAGTACCAAGAACGAAGAGAAAGTGATCTTAAACGGTGTCTCAGGCCTCGTTCAACCGGGGGAAATCCTCGCCATGCTCGGCCCCTCCGGGAGTGGCAAAACGACTCTCATAACCGCACTCGGAGGCCGGCTAGGCGGTCGACTCAGTGGCGCCATAACCTACAACAAAAAACCATTCTCAAACGCAATGAAAAGAAACACTGGCTTTGTAACCCAAGACGACTTTCTCTACCCCCACTTGACGGTCATCGAAACCCTATTCTACACAGCCCTTCTTCGCTTGCCCAACACGCTATCGAAAGCCAAGAAGGCTATGCAAGCTGAGGCCGTGATTATACAACTGGAGTTAACCAAGTGCAAGAACAGCGTTGTTGGGGGTGAGTTCTTGAGGGGTGTTTCGGGTGGGGAGAGAAGAAGGGTTAGCATAGGCCAAGAATTACTCGTAAACCCTAGCTTGCTCTTCTTGGATGAGCCCACGTCGGGACTCGATTCGACGACGGCGCAGCAGATTGTGTCAGCATTGTGGGATTTGGCAAGTGGAGGAAGAACAATTGTGATGACCATACATCAACCTTCAAGTAGGATTTTCTACATGTTTCATAAGGTGGTGTTGTTATCGGAAGGGAATTGTTTATATTTCGGAAAAGTATCGGAGGTCATGGACTATTTTTCGGGCATTGGCTATATACCATTGGTAGCTATGAATCCTGCGGATTTTCTGTTGGACCTTGCCAATGGTCTGGCACCTGATGGATCGCATGAAAACAAGAGCAAGGTGAAGCAGAGCCTAACCTTGGCCTATAAGCACAACCGTTTATATAATTTGAAAGCTCAACTTCAAGGGGAGCAACTTCAAGAAACCAACTCCAGCCATTTTCAAGATGGATCAGAAGACAAGAACTTTGCGAAATGGCCCACTACTTGGTGGCAGCAATTCTCTGTGTTGCTTAGGAGAGGACTGAAAGAGAGGAGGCACGAGTCCTTCTCTGGTAGCCAGATTAACCAGGTTGTGGCGGTGGCTCTTCTTGCTGGGCTACTATGGTGGCAGTCAAATATTTCCCACTTGCAGGATCGGACTGGGCTTCTCTTCTTTATGTCTGAATTTTGGGGGTTTTTCCCTCTGCTCCAAGCAATTTTCACCTTCCCCCAAGAGCGCAAGATGCTTGAAAAGGAAAGATCTTCAGGCACATACATGCTCTCCTCGTATTTCATATCAAGGATTGTTGCTGATCTCCCCATGGAGCTTGCCCTTCCAACCCTATTTGTCACCATAACATATTGGATGGCAGGGCTCAAACCCACAGCAGGACACTTTTTCCACACCTTGCTTGTTCTGCTACTCAGTGTGTTAGTGGCTCAAGGCATGGGGCTTGCTCTTGGGGCTCTGGTAATGGACCAAAAAAAGGCCGCAGTACTTGCATCAGTCCTCATGGTGTCATTTCAGCTAGCTGGAGGTTTCTTTGTTCAACATGTTCCTGCTTTCATTGCTTGGATCAAATACATTTCCATCATTAACTACTCATACAAGCTCTTGCTGGGGTCTCAATACAATGAAAATGACACTTACCTATGTGATAGTGGGGTTTGCTTGGTTAGAGATTTCCCAAGTATAAAACATGTTGGGCTTAGTGGACAAATAGGTGCAGCGGTTGCTTTGGCCATAATGCTTGTGGGTTGTAGGCTAATTGCTTATTTAGCTCTCATGAGGACTGGGTTGTAG


Protein sequences

Name Description Sequence
ppa017466m ABC-2 type transporter family protein (best arabidopsis hit)

MEKEMLDIDIQTATEAPTIFKEAIRPVTLKFEDVVYKIKQNNSTKNEEKVILNGVSGLVQPGEILAMLGPSGSGKTTLITALGGRLGGRLSGAITYNKKPFSNAMKRNTGFVTQDDFLYPHLTVIETLFYTALLRLPNTLSKAKKAMQAEAVIIQLELTKCKNSVVGGEFLRGVSGGERRRVSIGQELLVNPSLLFLDEPTSGLDSTTAQQIVSALWDLASGGRTIVMTIHQPSSRIFYMFHKVVLLSEGNCLYFGKVSEVMDYFSGIGYIPLVAMNPADFLLDLANGLAPDGSHENKSKVKQSLTLAYKHNRLYNLKAQLQGEQLQETNSSHFQDGSEDKNFAKWPTTWWQQFSVLLRRGLKERRHESFSGSQINQVVAVALLAGLLWWQSNISHLQDRTGLLFFMSEFWGFFPLLQAIFTFPQERKMLEKERSSGTYMLSSYFISRIVADLPMELALPTLFVTITYWMAGLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKAAVLASVLMVSFQLAGGFFVQHVPAFIAWIKYISIINYSYKLLLGSQYNENDTYLCDSGVCLVRDFPSIKHVGLSGQIGAAVALAIMLVGCRLIAYLALMRTGL*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF23
1-612 ATP-BINDING CASSETTE TRANSPORTER,ATP-BINDING CASSETTE TRANSPORTER

MEKEMLDIDIQTATEAPTIFKEAIRPVTLKFEDVVYKIKQNNSTKNEEKVILNGVSGLVQPGEILAMLGPSGSGKTTLITALGGRLGGRLSGAITYNKKPFSNAMKRNTGFVTQDDFLYPHLTVIETLFYTALLRLPNTLSKAKKAMQAEAVIIQLELTKCKNSVVGGEFLRGVSGGERRRVSIGQELLVNPSLLFLDEPTSGLDSTTAQQIVSALWDLASGGRTIVMTIHQPSSRIFYMFHKVVLLSEGNCLYFGKVSEVMDYFSGIGYIPLVAMNPADFLLDLANGLAPDGSHENKSKVKQSLTLAYKHNRLYNLKAQLQGEQLQETNSSHFQDGSEDKNFAKWPTTWWQQFSVLLRRGLKERRHESFSGSQINQVVAVALLAGLLWWQSNISHLQDRTGLLFFMSEFWGFFPLLQAIFTFPQERKMLEKERSSGTYMLSSYFISRIVADLPMELALPTLFVTITYWMAGLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKAAVLASVLMVSFQLAGGFFVQHVPAFIAWIKYISIINYSYKLLLGSQYNENDTYLCDSGVCLVRDFPSIKHVGLSGQIGAAVALAIMLVGCRLIAYLALMRT

HMMPanther: PTHR19241
1-612 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

MEKEMLDIDIQTATEAPTIFKEAIRPVTLKFEDVVYKIKQNNSTKNEEKVILNGVSGLVQPGEILAMLGPSGSGKTTLITALGGRLGGRLSGAITYNKKPFSNAMKRNTGFVTQDDFLYPHLTVIETLFYTALLRLPNTLSKAKKAMQAEAVIIQLELTKCKNSVVGGEFLRGVSGGERRRVSIGQELLVNPSLLFLDEPTSGLDSTTAQQIVSALWDLASGGRTIVMTIHQPSSRIFYMFHKVVLLSEGNCLYFGKVSEVMDYFSGIGYIPLVAMNPADFLLDLANGLAPDGSHENKSKVKQSLTLAYKHNRLYNLKAQLQGEQLQETNSSHFQDGSEDKNFAKWPTTWWQQFSVLLRRGLKERRHESFSGSQINQVVAVALLAGLLWWQSNISHLQDRTGLLFFMSEFWGFFPLLQAIFTFPQERKMLEKERSSGTYMLSSYFISRIVADLPMELALPTLFVTITYWMAGLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKAAVLASVLMVSFQLAGGFFVQHVPAFIAWIKYISIINYSYKLLLGSQYNENDTYLCDSGVCLVRDFPSIKHVGLSGQIGAAVALAIMLVGCRLIAYLALMRT

Gene3D: G3DSA:3.40.50.300
28-264 no description

TLKFEDVVYKIKQNNSTKNEEKVILNGVSGLVQPGEILAMLGPSGSGKTTLITALGGRLGGRLSGAITYNKKPFSNAMKRNTGFVTQDDFLYPHLTVIETLFYTALLRLPNTLSKAKKAMQAEAVIIQLELTKCKNSVVGGEFLRGVSGGERRRVSIGQELLVNPSLLFLDEPTSGLDSTTAQQIVSALWDLASGGRTIVMTIHQPSSRIFYMFHKVVLLSEGNCLYFGKVSEVMDY

superfamily: SSF52540
29-278 P-loop containing nucleoside triphosphate hydrolases

LKFEDVVYKIKQNNSTKNEEKVILNGVSGLVQPGEILAMLGPSGSGKTTLITALGGRLGGRLSGAITYNKKPFSNAMKRNTGFVTQDDFLYPHLTVIETLFYTALLRLPNTLSKAKKAMQAEAVIIQLELTKCKNSVVGGEFLRGVSGGERRRVSIGQELLVNPSLLFLDEPTSGLDSTTAQQIVSALWDLASGGRTIVMTIHQPSSRIFYMFHKVVLLSEGNCLYFGKVSEVMDYFSGIGYIPLVAMNP

ProfileScan: PS50893
IPR003439
29-274 ABC_TRANSPORTER_2
ABC transporter-like

LKFEDVVYKIKQNNSTKNEEKVILNGVSGLVQPGEILAMLGPSGSGKTTLITALGGRLGGRLSGAITYNKKPFSNAMKRNTGFVTQDDFLYPHLTVIETLFYTALLRLPNTLSKAKKAMQAEAVIIQLELTKCKNSVVGGEFLRGVSGGERRRVSIGQELLVNPSLLFLDEPTSGLDSTTAQQIVSALWDLASGGRTIVMTIHQPSSRIFYMFHKVVLLSEGNCLYFGKVSEVMDYFSGIGYIPLV

HMMSmart: SM00382
IPR003593
61-251 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGEILAMLGPSGSGKTTLITALGGRLGGRLSGAITYNKKPFSNAMKRNTGFVTQDDFLYPHLTVIETLFYTALLRLPNTLSKAKKAMQAEAVIIQLELTKCKNSVVGGEFLRGVSGGERRRVSIGQELLVNPSLLFLDEPTSGLDSTTAQQIVSALWDLASGGRTIVMTIHQPSSRIFYMFHKVVLLSEGN

HMMPfam: PF00005
IPR003439
76-202 ABC_tran
ABC transporter-like

TTLITALGGRLGGRLSGAITYNKKPFSNAMKRNTGFVTQDDFLYPHLTVIETLFYTALLRLPNTLSKAKKAMQAEAVIIQLELTKCKNSVVGGEFLRGVSGGERRRVSIGQELLVNPSLLFLDEPTS

Seg: seg
77-94 seg

TLITALGGRLGGRLSGAI

Seg: seg
172-185 seg

RGVSGGERRRVSIG

PatternScan: PS00211
IPR017871
174-188 ABC_TRANSPORTER_1
ABC transporter, conserved site

VSGGERRRVSIGQEL

HMMPfam: PF01061
IPR013525
352-557 ABC2_membrane
ABC-2 type transporter

QQFSVLLRRGLKERRHESFSGSQINQVVAVALLAGLLWWQSNISHLQDRTGLLFFMSEFWGFFPLLQAIFTFPQERKMLEKERSSGTYMLSSYFISRIVADLPMELALPTLFVTITYWMAGLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKAAVLASVLMVSFQLAGGFFVQHVPAFIAWIKYISIINYSYKLLLGSQ

Seg: seg
378-388 seg

VVAVALLAGLL

Seg: seg
484-493 seg

LLVLLLSVLV

Seg: seg
540-554 seg

IKYISIINYSYKLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox