PRGDB00172395 (ppa014995m)

From PRG Wiki
Jump to: navigation, search
ppa014995m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

S-locus lectin protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGACAAAATTCTTTCATTCATTTCCATTGGAATTTATGTGTTCCTCATTTTCTGCAGAACCTCAACTGCAGCTGATACCTTGATTTTCAAACATGGCAGCTTTCAATTGGGTTTCTTAAATACTGGGGTTTACCGGCGTCTATTAGCATCAACTTCAGGAGATTACTGTGACAACGATGGCCTTTGTGGAGCCAATGGAATGTGTGACATTAGTAATTCACAAGTCTGCAGTTGTTTAAAAGGGTTCAAGCCCAAAAGACCAGAAAAATGGAACTTGGGAGAATATACAGAAGGTTGTGTGCGGCCTGAACTTTTGAAATGCCAAATTAAAGTTGGGTTTATGAAATATGCTGCAGTGAAATTGCCAGATATCACAAATTGTTGGGTCAATCAAAGTATGAACCTCATGGAATGCAGAGCAAGTTGCTTGAGCAACTGTTCTTGTATGGCTTACTCAAGCTCCGGTATCAAAGGAGAAGGCAGTGGCTGCACCATCTGGTTTGGTGATCTTATCAACATTAGAAAGCTTTTGGCTGGTGGGCAGGATCTGTATATTCGAACGCCTGCTTCGGAACTGAACGCGAATTGCCGAAAGACAAAGATTGCAGTGATAGTTGTATCCATTGCTTCCATTGTTTCTGGGATGCTCTTAGCTGTTTGTTGCATTTGCCGTAAGAGTTCGAAGTTCAAAGAGAAAATGGGAAAGCATGGAACAATGAGTCAGAACTATGGACAGAAAGAAGACCTGGAGGTACCATTATTTAGTCTGTCCACAATAGCCACTGCTACTGACAACTTTTCATTCAACAAGAAGCTTGGAGAAGGTGGTTTTGGACCAGTATACAAGGGTAGACTAGTAGATGGGCAAGAAATTGCGGTGAAGAGGCTCTCACAAAGTTCAGGGCAAGGATCAAACGAGTTCAAAACCGAAGTACGACTAATAGCCAAACTTCAGCACCGAAATCTCGTGAGGCTTCTAGGTTGTTGCATTGAGGGCGAAGAGAAGTTGCTGATTTATGAGCACATGCCCAACAAAAGCTTGGACTTCTACATTTTTGATCAAACTCAAAGTAGACTGTTGTATTGGTCAAAACGCTTCCACATTATCTGTGGGATTGCCAGGGGTCTTCTCTATCTGCATCAAGATTCAAGATTGAGGATTATTCATAGAGATCTTAAAGCAAGTAATGTTTTACTTGACAAGGAGATGAACCCAAAAATCTCCGACTTCGGCTTAGCTAAAACTTTTGGAGGAGATCAGAATGAAGGAGTTACAAGAACTGTTGTTGGAACCTATGGTTATATGGCACCGGAATATGCCATTGATGGCCAATTCTCTGTAAAATCAGACGTTTTTAGCTTTGGCATTTTGTTGTTGGAGATAGTAAGTGGGAAGAGAAGTAGAGGATTTTATGATCCGGATGAACACCTTAACCTCATTGGACATGCATGGAGATTGTGGAAAGGAGGGAGGTCTCTAGAGTTGATTGATGAAAGCTTAAGCGACTCATGCGCTCTATCAGAAGTCTTGCACTGCATACACATTAGTCTTTTATGTGTGCAACAGCTTCCTGAAGACAGGCCAACCATGTCATCTGTGATTCTGATGTTAGGTGATGGGGGCGCCTTGCCTCAACCCAAAAGGCCAGGTTTCTTTGGTGGAAGATATTCATCTCAAGCAGATTCTTCGTCAAGTAAGAACGAAATATCTTCACCCTTTGACTCTACAATAACCGTGCTGGAGGCTCGATAA


Protein sequences

Name Description Sequence
ppa014995m S-locus lectin protein kinase family protein (best arabidopsis hit)

MDKILSFISIGIYVFLIFCRTSTAADTLIFKHGSFQLGFLNTGVYRRLLASTSGDYCDNDGLCGANGMCDISNSQVCSCLKGFKPKRPEKWNLGEYTEGCVRPELLKCQIKVGFMKYAAVKLPDITNCWVNQSMNLMECRASCLSNCSCMAYSSSGIKGEGSGCTIWFGDLINIRKLLAGGQDLYIRTPASELNANCRKTKIAVIVVSIASIVSGMLLAVCCICRKSSKFKEKMGKHGTMSQNYGQKEDLEVPLFSLSTIATATDNFSFNKKLGEGGFGPVYKGRLVDGQEIAVKRLSQSSGQGSNEFKTEVRLIAKLQHRNLVRLLGCCIEGEEKLLIYEHMPNKSLDFYIFDQTQSRLLYWSKRFHIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGLAKTFGGDQNEGVTRTVVGTYGYMAPEYAIDGQFSVKSDVFSFGILLLEIVSGKRSRGFYDPDEHLNLIGHAWRLWKGGRSLELIDESLSDSCALSEVLHCIHISLLCVQQLPEDRPTMSSVILMLGDGGALPQPKRPGFFGGRYSSQADSSSSKNEISSPFDSTITVLEAR*

Domains

Domain Start-End Description Sequence

HMMPfam: PF00954
IPR000858
27-86 S_locus_glycop
S-locus glycoprotein

TLIFKHGSFQLGFLNTGVYRRLLASTSGDYCDNDGLCGANGMCDISNSQVCSCLKGFKPK

ProfileScan: PS50026
IPR000742
53-89 EGF_3
Epidermal growth factor-like domain

SGDYCDNDGLCGANGMCDISNSQVCSCLKGFKPKRPE

HMMPanther: PTHR24420:SF703
57-572 SUBFAMILY NOT NAMED

CDNDGLCGANGMCDISNSQVCSCLKGFKPKRPEKWNLGEYTEGCVRPELLKCQIKVGFMKYAAVKLPDITNCWVNQSMNLMECRASCLSNCSCMAYSSSGIKGEGSGCTIWFGDLINIRKLLAGGQDLYIRTPASELNANCRKTKIAVIVVSIASIVSGMLLAVCCICRKSSKFKEKMGKHGTMSQNYGQKEDLEVPLFSLSTIATATDNFSFNKKLGEGGFGPVYKGRLVDGQEIAVKRLSQSSGQGSNEFKTEVRLIAKLQHRNLVRLLGCCIEGEEKLLIYEHMPNKSLDFYIFDQTQSRLLYWSKRFHIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGLAKTFGGDQNEGVTRTVVGTYGYMAPEYAIDGQFSVKSDVFSFGILLLEIVSGKRSRGFYDPDEHLNLIGHAWRLWKGGRSLELIDESLSDSCALSEVLHCIHISLLCVQQLPEDRPTMSSVILMLGDGGALPQPKRPGFFGGRYSSQADSSSSKNEISS

HMMPanther: PTHR24420
57-572 FAMILY NOT NAMED,FAMILY NOT NAMED

CDNDGLCGANGMCDISNSQVCSCLKGFKPKRPEKWNLGEYTEGCVRPELLKCQIKVGFMKYAAVKLPDITNCWVNQSMNLMECRASCLSNCSCMAYSSSGIKGEGSGCTIWFGDLINIRKLLAGGQDLYIRTPASELNANCRKTKIAVIVVSIASIVSGMLLAVCCICRKSSKFKEKMGKHGTMSQNYGQKEDLEVPLFSLSTIATATDNFSFNKKLGEGGFGPVYKGRLVDGQEIAVKRLSQSSGQGSNEFKTEVRLIAKLQHRNLVRLLGCCIEGEEKLLIYEHMPNKSLDFYIFDQTQSRLLYWSKRFHIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGLAKTFGGDQNEGVTRTVVGTYGYMAPEYAIDGQFSVKSDVFSFGILLLEIVSGKRSRGFYDPDEHLNLIGHAWRLWKGGRSLELIDESLSDSCALSEVLHCIHISLLCVQQLPEDRPTMSSVILMLGDGGALPQPKRPGFFGGRYSSQADSSSSKNEISS

HMMPfam: PF08276
IPR013227
108-174 PAN_2
PAN-2 domain

CQIKVGFMKYAAVKLPDITNCWVNQSMNLMECRASCLSNCSCMAYSSSGIKGEGSGCTIWFGDLINI

ProfileScan: PS50948
IPR003609
108-190 PAN
Apple-like

CQIKVGFMKYAAVKLPDITNCWVNQSMNLMECRASCLSNCSCMAYSSSGIKGEGSGCTIWFGDLINIRKLLAGGQDLYIRTPA

HMMSmart: SM00473
IPR003609
109-188 divergent subfamily of APPLE domains
Apple-like

QIKVGFMKYAAVKLPDITNCWVNQSMNLMECRASCLSNCSCMAYSSSGIKGEGSGCTIWFGDLINIRKLLAGGQDLYIRT

Seg: seg
202-214 seg

IAVIVVSIASIVS

superfamily: SSF56112
IPR011009
237-538 Protein kinase-like (PK-like)
Protein kinase-like domain

HGTMSQNYGQKEDLEVPLFSLSTIATATDNFSFNKKLGEGGFGPVYKGRLVDGQEIAVKRLSQSSGQGSNEFKTEVRLIAKLQHRNLVRLLGCCIEGEEKLLIYEHMPNKSLDFYIFDQTQSRLLYWSKRFHIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGLAKTFGGDQNEGVTRTVVGTYGYMAPEYAIDGQFSVKSDVFSFGILLLEIVSGKRSRGFYDPDEHLNLIGHAWRLWKGGRSLELIDESLSDSCALSEVLHCIHISLLCVQQLPEDRPTMSSVILML

Gene3D: G3DSA:3.30.200.20
251-328 no description

EVPLFSLSTIATATDNFSFNKKLGEGGFGPVYKGRLVDGQEIAVKRLSQSSGQGSNEFKTEVRLIAKLQHRNLVRLLG

ProfileScan: PS50011
IPR000719
267-552 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSFNKKLGEGGFGPVYKGRLVDGQEIAVKRLSQSSGQGSNEFKTEVRLIAKLQHRNLVRLLGCCIEGEEKLLIYEHMPNKSLDFYIFDQTQSRLLYWSKRFHIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGLAKTFGGDQNEGVTRTVVGTYGYMAPEYAIDGQFSVKSDVFSFGILLLEIVSGKRSRGFYDPDEHLNLIGHAWRLWKGGRSLELIDESLSDSCALSEVLHCIHISLLCVQQLPEDRPTMSSVILMLGDGGALPQPKRPGF

HMMSmart: SM00220
IPR002290
267-538 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSFNKKLGEGGFGPVYKGRLVDGQEIAVKRLSQSSGQGSNEFKTEVRLIAKLQHRNLVRLLGCCIEGEEKLLIYEHMPNKSLDFYIFDQTQSRLLYWSKRFHIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGLAKTFGGDQNEGVTRTVVGTYGYMAPEYAIDGQFSVKSDVFSFGILLLEIVSGKRSRGFYDPDEHLNLIGHAWRLWKGGRSLELIDESLSDSCALSEVLHCIHISLLCVQQLPEDRPTMSSVILML

HMMSmart: SM00219
IPR020635
267-538 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSFNKKLGEGGFGPVYKGRLVDGQEIAVKRLSQSSGQGSNEFKTEVRLIAKLQHRNLVRLLGCCIEGEEKLLIYEHMPNKSLDFYIFDQTQSRLLYWSKRFHIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGLAKTFGGDQNEGVTRTVVGTYGYMAPEYAIDGQFSVKSDVFSFGILLLEIVSGKRSRGFYDPDEHLNLIGHAWRLWKGGRSLELIDESLSDSCALSEVLHCIHISLLCVQQLPEDRPTMSSVILML

HMMPfam: PF07714
IPR001245
268-536 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SFNKKLGEGGFGPVYKGRLVDGQEIAVKRLSQSSGQGSNEFKTEVRLIAKLQHRNLVRLLGCCIEGEEKLLIYEHMPNKSLDFYIFDQTQSRLLYWSKRFHIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGLAKTFGGDQNEGVTRTVVGTYGYMAPEYAIDGQFSVKSDVFSFGILLLEIVSGKRSRGFYDPDEHLNLIGHAWRLWKGGRSLELIDESLSDSCALSEVLHCIHISLLCVQQLPEDRPTMSSVIL

Gene3D: G3DSA:1.10.510.10
329-534 no description

CCIEGEEKLLIYEHMPNKSLDFYIFDQTQSRLLYWSKRFHIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGLAKTFGGDQNEGVTRTVVGTYGYMAPEYAIDGQFSVKSDVFSFGILLLEIVSGKRSRGFYDPDEHLNLIGHAWRLWKGGRSLELIDESLSDSCALSEVLHCIHISLLCVQQLPEDRPTMSSV

PatternScan: PS00108
IPR008271
388-400 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNVLL

Seg: seg
493-504 seg

SLELIDESLSDS

HMMPfam: PF11883
IPR021820
543-584 DUF3403
S-locus receptor kinase, C-terminal

ALPQPKRPGFFGGRYSSQADSSSSKNEISSPFDSTITVLEAR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox