PRGDB00172398 (ppa004028m)

From PRG Wiki
Jump to: navigation, search
ppa004028m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGAATGAACTCACTGGTCCAATTCCTCCAGAGCTTGGGAACTTAACCAGTGTTGTGAAAATAAATCTTCAGTCAAATGGGTTGTCCGGTAGGCTACCTCCTGAACTTGGCAATTTGGCATACCTTGAGGAACTTCATTTGGATAGGAATAAGCTTCGAGGAACTCTTCCTGCCAATAGCTATACAAAATTACCTTCTAACCTCCATGGAATGTACGCCTCAAACTCAAACTTAACGGGCCTTTGTCGATCATCTCAGTTAAAAGTTGCAGATTTCTCATTCAACTTCTTTGTTGGTAACATACCTAAGTGCTTGGAGTATCTTCCCAGGTCAAGTTTTCAAGGAAATTGTCTCCAAAAAGAGGATCCCAAACAGCGTCCTGTAGAACTATGTGCTGGTGCGCCACCCTCTAAAGGACATCCAGGAGTTAATCCTAAGAACAAACCTGCTAAAGATGTCCCCAAACACCAGGAGACTTCAAAACCTGCCTGGCTGTTGGCTCTGGAAATAGTGACTGGAACCATGGTCTGTTCTCTCTTTCTTGTTGCTGTTTTCACTGCTCTTCAGAGATGCAATAGCAAATCTTCTATCATAATTCCTTGGAAGAAATCAGCAAGTGAAAAAGATCATATTGCAGTCTACATAGATTCCGAGATGTTGAAAGACGTTGTCAGATTCAACAGACAAGAGCTTGAGGTAGCCTGTGAAGACTTTAGCAACATTATTGGCTCCTCACCTGATAGTTTGGTTTACAAAGGCACGATGAAAGGTGGGCCTGAGATTGCTGTGATATCCCTTTGCATTAAGGAGGAGCATTGGACGGGCTATCTTGAACTCTATTTTCAGAGAGAGGTGACAGATTTGGCAAGATTAAATCACGAGAACGCAGCAAAATTACTGGGGTATTGTAGTGAGAGCACCCCATTTACGAGGATGCTGGTTTTTGAATATGCTTCAAATGGGACACTGTATGAGCACCTCCATTATGGAGAAGGATGCCAGTTAAGTTGGACACGGCGCATGAAAATTGTTATAGGAATTGCTCGGGGACTTAAGTATTTTCACACAGAGCTTGAGCCACCATTTACCATATCCGAGTTAAATTCTAGTGCTGTATATCTTACAGAAGATTTTTTACCCAAGCTGGTAGATTTTGAGAGTTGGAAGACAATTCTGGCGAGGTCAGAAAAGAACTCAGGCTCTATTAGCAGCCAAGGTGCTATTTGTGTTCTTCCAAATTCTATGGAAGCACGCCACCTGGATGTTAAAGGCAATGTTTATGCTTTTGGCATACTTTTGCTCGAAATAATCAGTGGTAGGCCTCCCTACTGCAAGGACAAAGGGTGCTTGATAGAATGGGCCAAAGACTATCTTGAGTTGCCAGATGTGATGCCTTATGTGGTGGATCCTGAACTGAAACATTTCAGTTACGACGACCTCAAAGTTTTATGTGATGTGGTGAATCTTTGCACCCATCCAGAGCCCACGAAGCGGCCTTCCATGCAGGAAATATGCACCATGTTGGAGAGCAGAATCGACACATCGGTGTCTATTGAGCTCAAGGCATCTTCTTTGGCATGGGCCGAGCTTGCACTTTCATCATAA


Protein sequences

Name Description Sequence
ppa004028m Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

MNELTGPIPPELGNLTSVVKINLQSNGLSGRLPPELGNLAYLEELHLDRNKLRGTLPANSYTKLPSNLHGMYASNSNLTGLCRSSQLKVADFSFNFFVGNIPKCLEYLPRSSFQGNCLQKEDPKQRPVELCAGAPPSKGHPGVNPKNKPAKDVPKHQETSKPAWLLALEIVTGTMVCSLFLVAVFTALQRCNSKSSIIIPWKKSASEKDHIAVYIDSEMLKDVVRFNRQELEVACEDFSNIIGSSPDSLVYKGTMKGGPEIAVISLCIKEEHWTGYLELYFQREVTDLARLNHENAAKLLGYCSESTPFTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMEARHLDVKGNVYAFGILLLEIISGRPPYCKDKGCLIEWAKDYLELPDVMPYVVDPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTMLESRIDTSVSIELKASSLAWAELALSS*

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-108 L domain-like,LRR

MNELTGPIPPELGNLTSVVKINLQSNGLSGRLPPELGNLAYLEELHLDRNKLRGTLPANSYTKLPSNLHGMYASNSNLTGLCRSSQLKVADFSFNFFVGNIPKCLEYL

Gene3D: G3DSA:3.80.10.10
2-123 no description

NELTGPIPPELGNLTSVVKINLQSNGLSGRLPPELGNLAYLEELHLDRNKLRGTLPANSYTKLPSNLHGMYASNSNLTGLCRSSQLKVADFSFNFFVGNIPKCLEYLPRSSFQGNCLQKEDP

HMMPanther: PTHR24420:SF812
2-512 LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN KINASE, PUTATIVE

NELTGPIPPELGNLTSVVKINLQSNGLSGRLPPELGNLAYLEELHLDRNKLRGTLPANSYTKLPSNLHGMYASNSNLTGLCRSSQLKVADFSFNFFVGNIPKCLEYLPRSSFQGNCLQKEDPKQRPVELCAGAPPSKGHPGVNPKNKPAKDVPKHQETSKPAWLLALEIVTGTMVCSLFLVAVFTALQRCNSKSSIIIPWKKSASEKDHIAVYIDSEMLKDVVRFNRQELEVACEDFSNIIGSSPDSLVYKGTMKGGPEIAVISLCIKEEHWTGYLELYFQREVTDLARLNHENAAKLLGYCSESTPFTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMEARHLDVKGNVYAFGILLLEIISGRPPYCKDKGCLIEWAKDYLELPDVMPYVVDPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTMLESRI

HMMPanther: PTHR24420
2-512 FAMILY NOT NAMED,FAMILY NOT NAMED

NELTGPIPPELGNLTSVVKINLQSNGLSGRLPPELGNLAYLEELHLDRNKLRGTLPANSYTKLPSNLHGMYASNSNLTGLCRSSQLKVADFSFNFFVGNIPKCLEYLPRSSFQGNCLQKEDPKQRPVELCAGAPPSKGHPGVNPKNKPAKDVPKHQETSKPAWLLALEIVTGTMVCSLFLVAVFTALQRCNSKSSIIIPWKKSASEKDHIAVYIDSEMLKDVVRFNRQELEVACEDFSNIIGSSPDSLVYKGTMKGGPEIAVISLCIKEEHWTGYLELYFQREVTDLARLNHENAAKLLGYCSESTPFTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMEARHLDVKGNVYAFGILLLEIISGRPPYCKDKGCLIEWAKDYLELPDVMPYVVDPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTMLESRI

Seg: seg
193-206 seg

SKSSIIIPWKKSAS

superfamily: SSF56112
IPR011009
208-508 Protein kinase-like (PK-like)
Protein kinase-like domain

KDHIAVYIDSEMLKDVVRFNRQELEVACEDFSNIIGSSPDSLVYKGTMKGGPEIAVISLCIKEEHWTGYLELYFQREVTDLARLNHENAAKLLGYCSESTPFTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMEARHLDVKGNVYAFGILLLEIISGRPPYCKDKGCLIEWAKDYLELPDVMPYVVDPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTML

Gene3D: G3DSA:3.30.200.20
221-302 no description

KDVVRFNRQELEVACEDFSNIIGSSPDSLVYKGTMKGGPEIAVISLCIKEEHWTGYLELYFQREVTDLARLNHENAAKLLGY

HMMSmart: SM00220
IPR002290
236-512 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

EDFSNIIGSSPDSLVYKGTMKGGPEIAVISLCIKEEHWTGYLELYFQREVTDLARLNHENAAKLLGYCSESTPFTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMEARHLDVKGNVYAFGILLLEIISGRPPYCKDKGCLIEWAKDYLELPDVMPYVVDPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTMLESRI

HMMSmart: SM00219
IPR020635
236-508 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

EDFSNIIGSSPDSLVYKGTMKGGPEIAVISLCIKEEHWTGYLELYFQREVTDLARLNHENAAKLLGYCSESTPFTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMEARHLDVKGNVYAFGILLLEIISGRPPYCKDKGCLIEWAKDYLELPDVMPYVVDPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTML

ProfileScan: PS50011
IPR000719
236-512 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

EDFSNIIGSSPDSLVYKGTMKGGPEIAVISLCIKEEHWTGYLELYFQREVTDLARLNHENAAKLLGYCSESTPFTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMEARHLDVKGNVYAFGILLLEIISGRPPYCKDKGCLIEWAKDYLELPDVMPYVVDPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTMLESRI

HMMPfam: PF07714
IPR001245
240-508 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NIIGSSPDSLVYKGTMKGGPEIAVISLCIKEEHWTGYLELYFQREVTDLARLNHENAAKLLGYCSESTPFTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMEARHLDVKGNVYAFGILLLEIISGRPPYCKDKGCLIEWAKDYLELPDVMPYVVDPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTML

Gene3D: G3DSA:1.10.510.10
303-508 no description

CSESTPFTRMLVFEYASNGTLYEHLHYGEGCQLSWTRRMKIVIGIARGLKYFHTELEPPFTISELNSSAVYLTEDFLPKLVDFESWKTILARSEKNSGSISSQGAICVLPNSMEARHLDVKGNVYAFGILLLEIISGRPPYCKDKGCLIEWAKDYLELPDVMPYVVDPELKHFSYDDLKVLCDVVNLCTHPEPTKRPSMQEICTML

Seg: seg
520-534 seg

LKASSLAWAELALSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox