PRGDB00172410 (ppa001152m)

From PRG Wiki
Jump to: navigation, search
ppa001152m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat transmembrane protein kinase (best arabidopsis hit)

DNA Sequence

ATGAGAAATGCTCTATTGAGACAAGTTCGATATAGAACCCCCTATCATTTAATTCTATACCTCTTCAACATGACTTGTTGCAGGTCCTTTGGATCAAATAATTTCTCCGGAACACTCCCTCCAGAACTTGGTAACTTAGTCAAGCTCGAGCAATGGTACATGGACAGCTGTGGACTTAGTGGGGAAATTCCTTCAACATTTGCTAAGCTCATCAACATGCAAATCCTCTGGGCATCAGACATTGCTTTCTCAGGAAAGATACCTGCTTTCATTGGGAATTGGACAAAACTGACTGTTTTGAGATTTCAAGGGAACTCTTTTGAAGGTCCAATACCAACCAGTTTTTCTCAACTGACTTCATTGAACACTCTGCGAATCAGTGATATATCTAATGTGAGCTCCTCTCTTGATTTTATAAGAAATTTGAAGAACTTGACCGATTTAGTTCTACGGAATGCATTAATCAATGGTAGCATTCCTTCTGATATTGGAGAATATGAAGGTTTACAGATACTGAATCTGGGTTTCAACAATTTAACAGGCCAACTCCCAAGTTCTTTGTTCAACATGAGTTCTCTTACATACTTGTTTCTTGGAAACAATAGCCTGTCTGGACCTCTTCCAAGCCAAAAGAGCGATCAACTTCAGACTATTGATTTGTCTTACAACTATTTATCAGGAAGCTTTCCCCAATGGGTAACCACAATATCACAACTGAACTTAGTGGTCAACAACTTCACATTTGGGAGTTCAAACATAACTCTTCCTGGACTGAATTGCCTCCAGAGGAATTTTCCATGCAATCGAGATACCCCTCGATATGCAAACTTCTCAATCAAGTGCGGAGGACCACAAATGAGAGGAAGTGATGGCATATTGTATGAAGCTGAAGACTCAGCTCTTGGCCCAGCAACATTTAATGTAACCAGTACACAGAAATGGGCTGTTAGCAATGTGGGTTTGTTTTCTGACAGAAAGAATCCATCATTTGTGGAAACCACCCTTACGCAAGTCACCGGTACAGATGTGACCCCAGAGCTTTTCCAGACTTCAAGACTGTCCCCAGGTTCACTTAGATACTATGGCCTGGGACTTCAGAATGGACCTTATACCGTAACGTTGCAATTTGCAGAAACGGTTTATGCTAGCCGTGCTACACAAACTTGGCAAAGTTTAGGAAGGCGTGTATTTGATATCTATATTCAAGGGAACCTCAGATGGAAGGACTTCGACATATCGAAGGAGGCAGGTGGGGTTAACAGAGCAGTTGGGAAACCCTTCAAGGTTAATGTGTCAGAGAATTACCTAGATATTCATCTGTTCTGGGCTGGTAAGGGAACATGTTGCATACCTGAACAAGGTGATTACGGCCCGCTAATATCGACTGTCCATGCTGCTTCAGATTTTACACCGACTGTTTCTGGGCTTCCACCAACTACTCCAGGAAAGAAGAGTAGGATTGGGTTGATAGTTGGTATTGCAGTCCCTGTTGGGGCTGTGAGCTTGCTATTATTATTTGGAGTTCTATATATGAGGAGAAAAAAATCAGAAAAAGATGACGATGAAGATCTTCTAGGATTAGGCCCCCGACCAAATACTTTCAGTTATGCTGAGTTGAGAGCTGCAACAGAAGATTTTAATCCTTCAAATAAGCTAGGAGAGGGAGGATATGGACCTGTTTATAAGGGTACACTATCTGATGGGAGGGTAGTGGCTGTGAAGCAACTTTCAGTAGCATCTCACCAAGGGAAGAGTCAATTTGTAACCGAGATTGCTACGATATCTGCAGTCCAACATCGCAATCTAGTGAAATTGTATGGATGCTGCATCGAAGGAACCCAGCGCATTTTGGTTTATGAGTATCTTGAAAACAAGAGCCTTGATCAGGCACTTTTTGGAAGAAATGACTTGCACCTTGACTGGCCTACCCGCTTCAATATATTGTTGGGAACAGCAAGAGGACTTGCTTACCTTCATGAGGAGTCAAGGCCCAGGATTGTACATCGAGATGTCAAAGCCAGTAATATTTTGATCGATGGAGAACTCTCCCCAAAAATATCAGATTTTGGATTGGCAAAGCTTTATGATGACGAAAAAACCCACATTAGCACCCGGGTTGCAGGGACAATAGGTTATTTGGCGCCGGAGTATGCAATGCGTGGACATCTGACAGAAAAGGCTGATGTTTTTGGTTTCGGGGTTGTTGCTTTGGAGATCCTCAGCGGGAGGCCAAACTCAGACAACAACTTGGATCCTGAAAAGATTTATCTTCTTGAATGGGCATGGACTCTACATGAAAACGACCAGAGTTTGGGGCTGGTGGATCCGAGATTGACAGAGTTTGATGAAAAGGAAGCAACTAGATTGATAAAAGCAGCTCTCCTCTGCACTCAGGCATCACCAATGATGAGGCCATCGATGTCACGCGTAGTGGCAATGCTCTCTGGAGATATTGAAGCAAGCACTGTTATTTCAAAGCCAAGTTATTTGACAGATTGGGATTTCAAAGATGTAACCACGAGTAGCTTTTTGTTGGATAATGATACCCCATCAACTGAGAGCAATGTTCATCCCAACCATCAGCCTGAAGGGACCACAACTAGTGTTAGCCCCGGGATTGACCTTTCGCCGTCTCCGGTAAATGTCACTGAATCAATGCTCACTGGCATTATAGGAGAAGGCAGGTGA


Protein sequences

Name Description Sequence
ppa001152m Leucine-rich repeat transmembrane protein kinase (best arabidopsis hit)

MRNALLRQVRYRTPYHLILYLFNMTCCRSFGSNNFSGTLPPELGNLVKLEQWYMDSCGLSGEIPSTFAKLINMQILWASDIAFSGKIPAFIGNWTKLTVLRFQGNSFEGPIPTSFSQLTSLNTLRISDISNVSSSLDFIRNLKNLTDLVLRNALINGSIPSDIGEYEGLQILNLGFNNLTGQLPSSLFNMSSLTYLFLGNNSLSGPLPSQKSDQLQTIDLSYNYLSGSFPQWVTTISQLNLVVNNFTFGSSNITLPGLNCLQRNFPCNRDTPRYANFSIKCGGPQMRGSDGILYEAEDSALGPATFNVTSTQKWAVSNVGLFSDRKNPSFVETTLTQVTGTDVTPELFQTSRLSPGSLRYYGLGLQNGPYTVTLQFAETVYASRATQTWQSLGRRVFDIYIQGNLRWKDFDISKEAGGVNRAVGKPFKVNVSENYLDIHLFWAGKGTCCIPEQGDYGPLISTVHAASDFTPTVSGLPPTTPGKKSRIGLIVGIAVPVGAVSLLLLFGVLYMRRKKSEKDDDEDLLGLGPRPNTFSYAELRAATEDFNPSNKLGEGGYGPVYKGTLSDGRVVAVKQLSVASHQGKSQFVTEIATISAVQHRNLVKLYGCCIEGTQRILVYEYLENKSLDQALFGRNDLHLDWPTRFNILLGTARGLAYLHEESRPRIVHRDVKASNILIDGELSPKISDFGLAKLYDDEKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGVVALEILSGRPNSDNNLDPEKIYLLEWAWTLHENDQSLGLVDPRLTEFDEKEATRLIKAALLCTQASPMMRPSMSRVVAMLSGDIEASTVISKPSYLTDWDFKDVTTSSFLLDNDTPSTESNVHPNHQPEGTTTSVSPGIDLSPSPVNVTESMLTGIIGEGR*

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
29-239 L domain-like,LRR

SFGSNNFSGTLPPELGNLVKLEQWYMDSCGLSGEIPSTFAKLINMQILWASDIAFSGKIPAFIGNWTKLTVLRFQGNSFEGPIPTSFSQLTSLNTLRISDISNVSSSLDFIRNLKNLTDLVLRNALINGSIPSDIGEYEGLQILNLGFNNLTGQLPSSLFNMSSLTYLFLGNNSLSGPLPSQKSDQLQTIDLSYNYLSGSFPQWVTTISQL

HMMPanther: PTHR24420
29-881 FAMILY NOT NAMED,FAMILY NOT NAMED

SFGSNNFSGTLPPELGNLVKLEQWYMDSCGLSGEIPSTFAKLINMQILWASDIAFSGKIPAFIGNWTKLTVLRFQGNSFEGPIPTSFSQLTSLNTLRISDISNVSSSLDFIRNLKNLTDLVLRNALINGSIPSDIGEYEGLQILNLGFNNLTGQLPSSLFNMSSLTYLFLGNNSLSGPLPSQKSDQLQTIDLSYNYLSGSFPQWVTTISQLNLVVNNFTFGSSNITLPGLNCLQRNFPCNRDTPRYANFSIKCGGPQMRGSDGILYEAEDSALGPATFNVTSTQKWAVSNVGLFSDRKNPSFVETTLTQVTGTDVTPELFQTSRLSPGSLRYYGLGLQNGPYTVTLQFAETVYASRATQTWQSLGRRVFDIYIQGNLRWKDFDISKEAGGVNRAVGKPFKVNVSENYLDIHLFWAGKGTCCIPEQGDYGPLISTVHAASDFTPTVSGLPPTTPGKKSRIGLIVGIAVPVGAVSLLLLFGVLYMRRKKSEKDDDEDLLGLGPRPNTFSYAELRAATEDFNPSNKLGEGGYGPVYKGTLSDGRVVAVKQLSVASHQGKSQFVTEIATISAVQHRNLVKLYGCCIEGTQRILVYEYLENKSLDQALFGRNDLHLDWPTRFNILLGTARGLAYLHEESRPRIVHRDVKASNILIDGELSPKISDFGLAKLYDDEKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGVVALEILSGRPNSDNNLDPEKIYLLEWAWTLHENDQSLGLVDPRLTEFDEKEATRLIKAALLCTQASPMMRPSMSRVVAMLSGDIEASTVISKPSYLTDWDFKDVTTSSFLLDNDTPSTESNVHPNHQPEGTTTSVSPGIDLSPSPVN

HMMPanther: PTHR24420:SF469
29-881 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SFGSNNFSGTLPPELGNLVKLEQWYMDSCGLSGEIPSTFAKLINMQILWASDIAFSGKIPAFIGNWTKLTVLRFQGNSFEGPIPTSFSQLTSLNTLRISDISNVSSSLDFIRNLKNLTDLVLRNALINGSIPSDIGEYEGLQILNLGFNNLTGQLPSSLFNMSSLTYLFLGNNSLSGPLPSQKSDQLQTIDLSYNYLSGSFPQWVTTISQLNLVVNNFTFGSSNITLPGLNCLQRNFPCNRDTPRYANFSIKCGGPQMRGSDGILYEAEDSALGPATFNVTSTQKWAVSNVGLFSDRKNPSFVETTLTQVTGTDVTPELFQTSRLSPGSLRYYGLGLQNGPYTVTLQFAETVYASRATQTWQSLGRRVFDIYIQGNLRWKDFDISKEAGGVNRAVGKPFKVNVSENYLDIHLFWAGKGTCCIPEQGDYGPLISTVHAASDFTPTVSGLPPTTPGKKSRIGLIVGIAVPVGAVSLLLLFGVLYMRRKKSEKDDDEDLLGLGPRPNTFSYAELRAATEDFNPSNKLGEGGYGPVYKGTLSDGRVVAVKQLSVASHQGKSQFVTEIATISAVQHRNLVKLYGCCIEGTQRILVYEYLENKSLDQALFGRNDLHLDWPTRFNILLGTARGLAYLHEESRPRIVHRDVKASNILIDGELSPKISDFGLAKLYDDEKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGVVALEILSGRPNSDNNLDPEKIYLLEWAWTLHENDQSLGLVDPRLTEFDEKEATRLIKAALLCTQASPMMRPSMSRVVAMLSGDIEASTVISKPSYLTDWDFKDVTTSSFLLDNDTPSTESNVHPNHQPEGTTTSVSPGIDLSPSPVN

Gene3D: G3DSA:3.80.10.10
31-246 no description

GSNNFSGTLPPELGNLVKLEQWYMDSCGLSGEIPSTFAKLINMQILWASDIAFSGKIPAFIGNWTKLTVLRFQGNSFEGPIPTSFSQLTSLNTLRISDISNVSSSLDFIRNLKNLTDLVLRNALINGSIPSDIGEYEGLQILNLGFNNLTGQLPSSLFNMSSLTYLFLGNNSLSGPLPSQKSDQLQTIDLSYNYLSGSFPQWVTTISQLNLVVNNF

HMMPfam: PF00560
IPR001611
169-188 LRR_1
Leucine-rich repeat

LQILNLGFNNLTGQLPSSLF

HMMPfam: PF11721
IPR021720
276-461 Malectin
Malectin

NFSIKCGGPQMRGSDGILYEAEDSALGPATFNVTSTQKWAVSNVGLFSDRKNPSFVETTLTQVTGTDVTPELFQTSRLSPGSLRYYGLGLQNGPYTVTLQFAETVYASRATQTWQSLGRRVFDIYIQGNLRWKDFDISKEAGGVNRAVGKPFKVNVSENYLDIHLFWAGKGTCCIPEQGDYGPLIS

Seg: seg
331-344 seg

VETTLTQVTGTDVT

Seg: seg
512-531 seg

RRKKSEKDDDEDLLGLGPRP

superfamily: SSF56112
IPR011009
516-814 Protein kinase-like (PK-like)
Protein kinase-like domain

SEKDDDEDLLGLGPRPNTFSYAELRAATEDFNPSNKLGEGGYGPVYKGTLSDGRVVAVKQLSVASHQGKSQFVTEIATISAVQHRNLVKLYGCCIEGTQRILVYEYLENKSLDQALFGRNDLHLDWPTRFNILLGTARGLAYLHEESRPRIVHRDVKASNILIDGELSPKISDFGLAKLYDDEKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGVVALEILSGRPNSDNNLDPEKIYLLEWAWTLHENDQSLGLVDPRLTEFDEKEATRLIKAALLCTQASPMMRPSMSRVVAML

Gene3D: G3DSA:3.30.200.20
531-607 no description

PNTFSYAELRAATEDFNPSNKLGEGGYGPVYKGTLSDGRVVAVKQLSVASHQGKSQFVTEIATISAVQHRNLVKLYG

ProfileScan: PS50011
IPR000719
546-824 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNPSNKLGEGGYGPVYKGTLSDGRVVAVKQLSVASHQGKSQFVTEIATISAVQHRNLVKLYGCCIEGTQRILVYEYLENKSLDQALFGRNDLHLDWPTRFNILLGTARGLAYLHEESRPRIVHRDVKASNILIDGELSPKISDFGLAKLYDDEKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGVVALEILSGRPNSDNNLDPEKIYLLEWAWTLHENDQSLGLVDPRLTEFDEKEATRLIKAALLCTQASPMMRPSMSRVVAMLSGDIEASTVI

HMMSmart: SM00219
IPR020635
546-814 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNPSNKLGEGGYGPVYKGTLSDGRVVAVKQLSVASHQGKSQFVTEIATISAVQHRNLVKLYGCCIEGTQRILVYEYLENKSLDQALFGRNDLHLDWPTRFNILLGTARGLAYLHEESRPRIVHRDVKASNILIDGELSPKISDFGLAKLYDDEKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGVVALEILSGRPNSDNNLDPEKIYLLEWAWTLHENDQSLGLVDPRLTEFDEKEATRLIKAALLCTQASPMMRPSMSRVVAML

HMMSmart: SM00220
IPR002290
546-814 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNPSNKLGEGGYGPVYKGTLSDGRVVAVKQLSVASHQGKSQFVTEIATISAVQHRNLVKLYGCCIEGTQRILVYEYLENKSLDQALFGRNDLHLDWPTRFNILLGTARGLAYLHEESRPRIVHRDVKASNILIDGELSPKISDFGLAKLYDDEKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGVVALEILSGRPNSDNNLDPEKIYLLEWAWTLHENDQSLGLVDPRLTEFDEKEATRLIKAALLCTQASPMMRPSMSRVVAML

HMMPfam: PF07714
IPR001245
549-814 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SNKLGEGGYGPVYKGTLSDGRVVAVKQLSVASHQGKSQFVTEIATISAVQHRNLVKLYGCCIEGTQRILVYEYLENKSLDQALFGRNDLHLDWPTRFNILLGTARGLAYLHEESRPRIVHRDVKASNILIDGELSPKISDFGLAKLYDDEKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGVVALEILSGRPNSDNNLDPEKIYLLEWAWTLHENDQSLGLVDPRLTEFDEKEATRLIKAALLCTQASPMMRPSMSRVVAML

Gene3D: G3DSA:1.10.510.10
608-812 no description

CCIEGTQRILVYEYLENKSLDQALFGRNDLHLDWPTRFNILLGTARGLAYLHEESRPRIVHRDVKASNILIDGELSPKISDFGLAKLYDDEKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGVVALEILSGRPNSDNNLDPEKIYLLEWAWTLHENDQSLGLVDPRLTEFDEKEATRLIKAALLCTQASPMMRPSMSRVVA

PatternScan: PS00108
IPR008271
666-678 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDVKASNILI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox