PRGDB00172415 (ppa000373m)

From PRG Wiki
Jump to: navigation, search
ppa000373m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Prunus persica

Comment?

LRR and NB-ARC domains-containing disease resistance protein (best arabidopsis hit)

DNA Sequence

ATGGCAGAAGTTGTTACTTTTGGTGTCCAGGAAACACTGAGGAAAGTGGCTTCACTTGCCGCTCAAGACTTGAGTCTTCTGTGGGGCTTCGAAGGAGAGGTCACAAAGCTGCGTGATTCGCTGTCCATGGCTCGAGCTGTGTTGCGAGATGCCGGACAATCTAAAGGAAGGACCGAGGCGGTGGGCATGTGGGTGGAGAAGCTTGAAGACATAGCTCATGAGGCTGATGATGTGCTGGATGAATACAGATATGAACTTCTCCGGCGTAAGGTCGAAGTGCAAAAGCAAATGAAGAAAAACGTGAGCAACTTCTTTTCACTCCACAATCCAATTGCATTTCGCCTCAAAATGGCACATAAGATTACGAAGGTGAACGCTGCTTTGGAAAATTTGAATAACAAGGCAGCTGGCATTGGGCTTGTTGCTAGGTCATCGAGATTCGAACCTGAAACTTCTCATAGAGGAGTAGCACTACTTGACAGGGAAACCGTCTCCAGCTTTGCTCAAGATGAGAAGTACATCGTTGGAAGGGAGGAGGTTGTGTCACACATAGTTACAACCTTGACCAACTCAAGCAATTACCAAGAGAACTATCTCTCGGTGATGCCCATTGTGGGAATGGGAGGGTTGGGGAAAACAACTTTGGCTAAATCTATATATCATCATCGGGAGATCAGTAGGCACTTTGACAAAAAAATATGGATATGTGTATCCACCTCTTTTAAAGTCAAGAAGATTTTAAGCGGGATCTTGGAAAAACTTAAACCAGAAAAAGCTGGGATACGAAGCAAGGCAACAATATGTGAAAACCTCCAAGAAGATTTGAAAGGGAAACGGTATCTTGTGGTGCTTGATGATGTTTGGAATGATGATCCTCAAAAATGGGATAATTTGATCAGTTGTCTGTTAAGTGTTAAAGATACTCAAGGAAGCACAATCATTGTCACTACCCGCAGTGTGACTGTTGCATCAATCGTCCAAACACTTCCTCGAGCATTTCCTGATGGGAGTGCTCCTTTAGATTTAGATGAAGCTCAAGAGAGAATTGGAAGGGACATCGCCAAAAAGTGTGCAGGTGTACCATTAGTGGCAAAGGTTTTGGGAAGTATGATGCGCTCCAAAAAAAGTGATGGATGGAAGTCAATTCAGAAAAGTACAATATGGGATTTGCAAGAAGAAGAACAAAGAATATTGTCGGTTTTGAAGTTGAGTTTTGATGAACTTAAATCAGCATCTTTGAAGCAATGTTTTGCATATTGCTCAATGTTCATCAAAGATTTTACAATTGAAAAGGATGACTTGATCCAACTTTGGATGGCTCAGGGGTTGCTTCACCTTTCTCCCACAAGCAGTAATCGAGAGATGGAGGACATAGGAAATGAATATTTTAATATTCTATTGCAGAACTCGTTCTTTCAAGATGTTGCAAAGGATAGCTATAATGTGATTACCCATTGCAAAATGCACGATCTTGTGCATGATCTTGCAGAACATGTATCAAAGAGCATGGGATCCAACGGAATTCGACATATGTCTCAAATTTCTACCTCACTACTACAAGAAATTCCAAAAAGAAGTGTTCATAGATTGCGCTCAGTCTTTTCGAATGGTGAAGATCTTGGTAACATCTTACCAAGCTTGAAAGGTTTACGTATCTTAAGTTTAAAGAAAGCTGATATTGATGAGTTACCAATTTCAATTGGGAAGTTGAAACACTTGAGGTACCTAGATATTTCAAAAACAAAGATCAAACTGCTCCCCCAATCTATTGGCAAGCTTTACAATCTACAGACACTAAGAATGGATGATCTCAAAGTTGAAGAGTTTCCAAAAGAACTGCAAAATTTGATCAACCTGAGGCATTTTTATTTTGATAAGGATCCTATGAAATTTCCAGTTGATATGGGGCGGTTGAGTAATCTCCGATCATTATCTTTTTTCATTGTGGGTAAGGAGAGAGGTCGTGGAATAGAGGAGTTGGCTGGCTTAAAGCATTTGAAAGGCGAATTATCTATTTATGATTTGCAACATGTGACAGATGGGGAAGAAGCAAAGAAAGCAAAGTTGGCGGAGAAGACAAACATACGCAAACTAAGGTTTGAATGGCAGGGAAACAGGTCAAGCGCCATCAACATTGACAGGGATGTACTAGAAGACCTTAAACCGCCCTCTGAATTGGAACTTTTAGAGATTTGCAAGTTTAGCGGGGATAAATTTCCATCATGGATGATGAGTGGTTATTTGTTTCATGAATTGAAAAGATTAACAATTGATAAAGCAAGGTACCTAATTGAATGGACGGAAATTGCAGCATTGCCAACAGAAGGAACAATAGTGTTGTTTCCTCGGCTTGAGGAGCTGTTGTTGAGGAATTGCGATCAATTGACAAGTGCTCCCACTCGTTTTCCATGTCTCCAAAAGTTGGAGATAGAGTCCATGGATAGCGGCATGCCAATATCTAATATAAGCACCCATCTGACCACTCTTACTTGTCTCATAATAAAGAAGATAAGGAGACTTACTTGTCTGCCGGAAGGGATGTTAAAAAGCAACAAGAATCTTTCATATTTGGAGATAAAGGATTGTCCAGAGTTAACTTGTATTGTTGACGATGTATACGGATGTTGTGCATCTCTGGAGGAACTGCGTATTTCCAAGTGTCCTAATCTTAGGACTTTGCCTGATGGCCTACACACTCTACTCTCTCTTAGGAAGTTCATTATTGATAACTGCAAAAGTCTGGAGTGCATTCCCGTTACATACGGCCTCACATCTCTTTGTGAATTTTCCGTTTGGTTCTGTCCTCAACTACCCAGTCTACCTGAGGGGCTAGAATACTGCACCTCTCTTCAAATGTTGACAATTAGAAAATGCTCCAAAATAAGCTCCATCCCAATTACACAGGGCCTCCCATTCCTTCGCGAAATAAAGATTTCGTGGTGTGCACAATTATCAAGCCTACCGAGTGGGTTAGAATATTGTACCTCTCTTCAGAAGTTGACAATTGAATATTGTACGAGTGTAGAGTTTGTTCAAACTTTACATGGCTTTACATCCCTCCGTCAATTGAGCTTGTACAGAATTTCTGGGAAAATTCTACTATCTGCGCTTGAATCATGTACCTCTCTTGAGATATTGTCGATAAGCTATTGCCCGAATCTCGAAACTATTCCAAGATTAGACAGCCTCACACACCTCCGTAAGTTGGCGATATACGAGTGTGAAGTATTAAAAAGTGTACCTAGTGCGTTAGCATCCTCACACTACAGCCTCACTCGCTTGATAAAATTGGAAGTTGGCGGGTTCTGGAAGGAGCTTGATTCATTTCCTGCTTTTCACGTTATCCCACAACTTGAAGAATTAACCTTGTACGGTTGGCCAAAGCTGAACTCTCTGCCTGAACAAGTTCAACACTTCACTTCCCTGACATATTTGGAAATATACTCCTTTGACGGATTGGAGGCTCTTCCAGAGTGGTTGAGAAACCTTACATCTCTTGAGTGCCTATTTATATCCATGTCCAAGAATCTGATGTATCTACCTACAATTGAAGCTATGCAGTGCCTCACCAAATTACAGCACATACACATTTATCATTGTCCTCTTCTAAAAGAAAGATGCATCAAGGACATCGGCCCAGAGTGGCACAAGATTTCACACATTTCAACAATCCGTGTTGACCGTGTGAAATGGTCCTGA


Protein sequences

Name Description Sequence
ppa000373m LRR and NB-ARC domains-containing disease resistance protein (best arabidopsis hit)

MAEVVTFGVQETLRKVASLAAQDLSLLWGFEGEVTKLRDSLSMARAVLRDAGQSKGRTEAVGMWVEKLEDIAHEADDVLDEYRYELLRRKVEVQKQMKKNVSNFFSLHNPIAFRLKMAHKITKVNAALENLNNKAAGIGLVARSSRFEPETSHRGVALLDRETVSSFAQDEKYIVGREEVVSHIVTTLTNSSNYQENYLSVMPIVGMGGLGKTTLAKSIYHHREISRHFDKKIWICVSTSFKVKKILSGILEKLKPEKAGIRSKATICENLQEDLKGKRYLVVLDDVWNDDPQKWDNLISCLLSVKDTQGSTIIVTTRSVTVASIVQTLPRAFPDGSAPLDLDEAQERIGRDIAKKCAGVPLVAKVLGSMMRSKKSDGWKSIQKSTIWDLQEEEQRILSVLKLSFDELKSASLKQCFAYCSMFIKDFTIEKDDLIQLWMAQGLLHLSPTSSNREMEDIGNEYFNILLQNSFFQDVAKDSYNVITHCKMHDLVHDLAEHVSKSMGSNGIRHMSQISTSLLQEIPKRSVHRLRSVFSNGEDLGNILPSLKGLRILSLKKADIDELPISIGKLKHLRYLDISKTKIKLLPQSIGKLYNLQTLRMDDLKVEEFPKELQNLINLRHFYFDKDPMKFPVDMGRLSNLRSLSFFIVGKERGRGIEELAGLKHLKGELSIYDLQHVTDGEEAKKAKLAEKTNIRKLRFEWQGNRSSAINIDRDVLEDLKPPSELELLEICKFSGDKFPSWMMSGYLFHELKRLTIDKARYLIEWTEIAALPTEGTIVLFPRLEELLLRNCDQLTSAPTRFPCLQKLEIESMDSGMPISNISTHLTTLTCLIIKKIRRLTCLPEGMLKSNKNLSYLEIKDCPELTCIVDDVYGCCASLEELRISKCPNLRTLPDGLHTLLSLRKFIIDNCKSLECIPVTYGLTSLCEFSVWFCPQLPSLPEGLEYCTSLQMLTIRKCSKISSIPITQGLPFLREIKISWCAQLSSLPSGLEYCTSLQKLTIEYCTSVEFVQTLHGFTSLRQLSLYRISGKILLSALESCTSLEILSISYCPNLETIPRLDSLTHLRKLAIYECEVLKSVPSALASSHYSLTRLIKLEVGGFWKELDSFPAFHVIPQLEELTLYGWPKLNSLPEQVQHFTSLTYLEIYSFDGLEALPEWLRNLTSLECLFISMSKNLMYLPTIEAMQCLTKLQHIHIYHCPLLKERCIKDIGPEWHKISHISTIRVDRVKWS*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
25-1172 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SLLWGFEGEVTKLRDSLSMARAVLRDAGQSKGRTEAVGMWVEKLEDIAHEADDVLDEYRYELLRRKVEVQKQMKKNVSNFFSLHNPIAFRLKMAHKITKVNAALENLNNKAAGIGLVARSSRFEPETSHRGVALLDRETVSSFAQDEKYIVGREEVVSHIVTTLTNSSNYQENYLSVMPIVGMGGLGKTTLAKSIYHHREISRHFDKKIWICVSTSFKVKKILSGILEKLKPEKAGIRSKATICENLQEDLKGKRYLVVLDDVWNDDPQKWDNLISCLLSVKDTQGSTIIVTTRSVTVASIVQTLPRAFPDGSAPLDLDEAQERIGRDIAKKCAGVPLVAKVLGSMMRSKKSDGWKSIQKSTIWDLQEEEQRILSVLKLSFDELKSASLKQCFAYCSMFIKDFTIEKDDLIQLWMAQGLLHLSPTSSNREMEDIGNEYFNILLQNSFFQDVAKDSYNVITHCKMHDLVHDLAEHVSKSMGSNGIRHMSQISTSLLQEIPKRSVHRLRSVFSNGEDLGNILPSLKGLRILSLKKADIDELPISIGKLKHLRYLDISKTKIKLLPQSIGKLYNLQTLRMDDLKVEEFPKELQNLINLRHFYFDKDPMKFPVDMGRLSNLRSLSFFIVGKERGRGIEELAGLKHLKGELSIYDLQHVTDGEEAKKAKLAEKTNIRKLRFEWQGNRSSAINIDRDVLEDLKPPSELELLEICKFSGDKFPSWMMSGYLFHELKRLTIDKARYLIEWTEIAALPTEGTIVLFPRLEELLLRNCDQLTSAPTRFPCLQKLEIESMDSGMPISNISTHLTTLTCLIIKKIRRLTCLPEGMLKSNKNLSYLEIKDCPELTCIVDDVYGCCASLEELRISKCPNLRTLPDGLHTLLSLRKFIIDNCKSLECIPVTYGLTSLCEFSVWFCPQLPSLPEGLEYCTSLQMLTIRKCSKISSIPITQGLPFLREIKISWCAQLSSLPSGLEYCTSLQKLTIEYCTSVEFVQTLHGFTSLRQLSLYRISGKILLSALESCTSLEILSISYCPNLETIPRLDSLTHLRKLAIYECEVLKSVPSALASSHYSLTRLIKLEVGGFWKELDSFPAFHVIPQLEELTLYGWPKLNSLPEQVQHFTSLTYLEIYSFDGLEALPEWLRNLTSLECLFIS

Coil: coil
65-86 coiled-coil

VEKLEDIAHEADDVLDEYRYEL

Seg: seg
125-136 seg

NAALENLNNKAA

superfamily: SSF52540
157-393 P-loop containing nucleoside triphosphate hydrolases

ALLDRETVSSFAQDEKYIVGREEVVSHIVTTLTNSSNYQENYLSVMPIVGMGGLGKTTLAKSIYHHREISRHFDKKIWICVSTSFKVKKILSGILEKLKPEKAGIRSKATICENLQEDLKGKRYLVVLDDVWNDDPQKWDNLISCLLSVKDTQGSTIIVTTRSVTVASIVQTLPRAFPDGSAPLDLDEAQERIGRDIAKKCAGVPLVAKVLGSMMRSKKSDGWKSIQKSTIWDLQEE

Gene3D: G3DSA:3.40.50.300
175-324 no description

VGREEVVSHIVTTLTNSSNYQENYLSVMPIVGMGGLGKTTLAKSIYHHREISRHFDKKIWICVSTSFKVKKILSGILEKLKPEKAGIRSKATICENLQEDLKGKRYLVVLDDVWNDDPQKWDNLISCLLSVKDTQGSTIIVTTRSVTVAS

HMMPfam: PF00931
IPR002182
178-327 NB-ARC,NBS
NB-ARC

EEVVSHIVTTLTNSSNYQENYLSVMPIVGMGGLGKTTLAKSIYHHREISRHFDKKIWICVSTSFKVKKILSGILEKLKPEKAGIRSKATICENLQEDLKGKRYLVVLDDVWNDDPQKWDNLISCLLSVKDTQGSTIIVTTRSVTVASIVQ

FPrintScan: PR00364
IPR000767
201-216 DISEASERSIST
Disease resistance protein

VMPIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
274-288 DISEASERSIST
Disease resistance protein

DLKGKRYLVVLDDVW

Seg: seg
311-326 seg

STIIVTTRSVTVASIV

HMMPfam: PF00931
IPR002182
344-446 NB-ARC,NBS
NB-ARC

EAQERIGRDIAKKCAGVPLVAKVLGSMMRSKKSDGWKSIQKSTIWDLQEEEQRILSVLKLSFDELKSASLKQCFAYCSMFIKDFTIEKDDLIQLWMAQGLLHL

FPrintScan: PR00364
IPR000767
357-371 DISEASERSIST
Disease resistance protein

CAGVPLVAKVLGSMM

superfamily: SSF52058
487-935 L domain-like,LRR

KMHDLVHDLAEHVSKSMGSNGIRHMSQISTSLLQEIPKRSVHRLRSVFSNGEDLGNILPSLKGLRILSLKKADIDELPISIGKLKHLRYLDISKTKIKLLPQSIGKLYNLQTLRMDDLKVEEFPKELQNLINLRHFYFDKDPMKFPVDMGRLSNLRSLSFFIVGKERGRGIEELAGLKHLKGELSIYDLQHVTDGEEAKKAKLAEKTNIRKLRFEWQGNRSSAINIDRDVLEDLKPPSELELLEICKFSGDKFPSWMMSGYLFHELKRLTIDKARYLIEWTEIAALPTEGTIVLFPRLEELLLRNCDQLTSAPTRFPCLQKLEIESMDSGMPISNISTHLTTLTCLIIKKIRRLTCLPEGMLKSNKNLSYLEIKDCPELTCIVDDVYGCCASLEELRISKCPNLRTLPDGLHTLLSLRKFIIDNCKSLECIPVTYGLTSLCEFSVWFCP

Gene3D: G3DSA:3.80.10.10
516-645 no description

TSLLQEIPKRSVHRLRSVFSNGEDLGNILPSLKGLRILSLKKADIDELPISIGKLKHLRYLDISKTKIKLLPQSIGKLYNLQTLRMDDLKVEEFPKELQNLINLRHFYFDKDPMKFPVDMGRLSNLRSLS

FPrintScan: PR00364
IPR000767
568-584 DISEASERSIST
Disease resistance protein

GKLKHLRYLDISKTKIK

Seg: seg
682-692 seg

EEAKKAKLAEK

Gene3D: G3DSA:3.80.10.10
730-925 no description

EICKFSGDKFPSWMMSGYLFHELKRLTIDKARYLIEWTEIAALPTEGTIVLFPRLEELLLRNCDQLTSAPTRFPCLQKLEIESMDSGMPISNISTHLTTLTCLIIKKIRRLTCLPEGMLKSNKNLSYLEIKDCPELTCIVDDVYGCCASLEELRISKCPNLRTLPDGLHTLLSLRKFIIDNCKSLECIPVTYGLTS

superfamily: SSF52058
876-1220 L domain-like,LRR

CASLEELRISKCPNLRTLPDGLHTLLSLRKFIIDNCKSLECIPVTYGLTSLCEFSVWFCPQLPSLPEGLEYCTSLQMLTIRKCSKISSIPITQGLPFLREIKISWCAQLSSLPSGLEYCTSLQKLTIEYCTSVEFVQTLHGFTSLRQLSLYRISGKILLSALESCTSLEILSISYCPNLETIPRLDSLTHLRKLAIYECEVLKSVPSALASSHYSLTRLIKLEVGGFWKELDSFPAFHVIPQLEELTLYGWPKLNSLPEQVQHFTSLTYLEIYSFDGLEALPEWLRNLTSLECLFISMSKNLMYLPTIEAMQCLTKLQHIHIYHCPLLKERCIKDIGPEWHKISH

Gene3D: G3DSA:3.80.10.10
926-1110 no description

LCEFSVWFCPQLPSLPEGLEYCTSLQMLTIRKCSKISSIPITQGLPFLREIKISWCAQLSSLPSGLEYCTSLQKLTIEYCTSVEFVQTLHGFTSLRQLSLYRISGKILLSALESCTSLEILSISYCPNLETIPRLDSLTHLRKLAIYECEVLKSVPSALASSHYSLTRLIKLEVGGFWKELDSFP

HMMPfam: PF00560
IPR001611
1042-1063 LRR_1
Leucine-rich repeat

SLEILSISYCPNLETIPRLDSL

Gene3D: G3DSA:3.80.10.10
1112-1219 no description

FHVIPQLEELTLYGWPKLNSLPEQVQHFTSLTYLEIYSFDGLEALPEWLRNLTSLECLFISMSKNLMYLPTIEAMQCLTKLQHIHIYHCPLLKERCIKDIGPEWHKIS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox