PRGDB00172422 (ppa002163m)

From PRG Wiki
Jump to: navigation, search
ppa002163m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGGTTCTCCACCAAAAGTCTCTGACTTTTATCATTATCATCACCATCCTTGTCACTACAACCTCCATAGCCACCATAGCCAGAGCTCAAAACTCAAGCTCCTGCAACCCCACATGCGGATCGGGAAAATCAGCCAAGTCGGTTCAGTACCCATTTGGGTTCTCAAAAGGATGCGTAATCCCATTGAACTGTTCTGACAAAAACGAAATCAAACTCGGCGAATTCACAGTCCAAGACGTAACCAGAAGCAGCATCTTCGTCCACCTCCCTGCAAAATGTAACAGAAAGTACCAATCCATAGCCCCTCTCTTCGGCCTAAACTTCGGCCCAAGCTGGAACAACAGCCTTCTCTTCCAAAACTGCACATCCCCACTCCCTGGCTGCCAAATCCCAGCTGAATTTGTTCAGAAGCGGTTCAATTTATCCAGCTGCGATAATATCACCTGTATGTCACAGCCGCCTAACGGCTCCGATATTATGACATTTGAGGACTTGAATCGGACCCGGTGCAAATACTTGTTCGGGTCGTTTTCGGTTCAGTCGGGTCGGGACTCGCTGCTGTCGCTCGAGTTCGAGACGCTTCAGTTGGGTTGGTGGGTCAACACCAGCCTTGGTGAATGCCATTCGAATGCCATGTCTACGACGGTGAAGCCCGGTGGGGGGAAGCCGCCTGGGTGCCGATGCAGCTGCAACGCTGGGTTTGACGGCGACGGGTTCAAACTCGGGTCGGGTTGCCAGCCAGTGAGCCAACCGGTTTCTCATTGCAATGCTTCAAAGTACATGTCTGGTCGTTGTGGGGGAACAACTAGAGTTGCTGTTCTTATCGGAGGGTTTGTTGCTGGAGCTTTCTTAATGGCCGGTCTATTTCTTCTCTGCTACTTTGTTCGACGCCGTTCCACTTGCTTGAGAAACCAGCTGTGTGCAAGGCGCCTTCTAAGTGAAGCTGCAGGCAACTCTAGTGTCCCATTATATCCCTATAAAGAAATAGAAAGAGCCACTAATTGCTTTGCTGAGAAACAAAGGCTGGGCACAGGGGCTTTTGGTATAGTGTATGCAGGAAAACTCCACAATGATGAGTGGGTTGCCATAAAAAAGATTAACCGGCGAGACACCAACAGCATTGATCAAGTCATGAATGAGATCAAGCTCCTTTCCTCTGTGAGCCACCCGAATCTAGTACGCCTCTTAGGTTGCTGCATAGAGGGGGGTGAACAGATCCTTGTCTATGAATATATGCCTAATGGAACTCTGTCTGAACATCTGCAAAGAGAGAGGGGCCAAGGACTTCCATGGACCATAAGGCTCACGATCGCTGCCGAAACTGCTAATGCTATAGCCTATCTCCATTCTGCAATGAATCCACCAATCTATCATAGAGACATCAAATCCAGCAATATACTCCTGGACTACAACTACAAATCAAAGGTAGCAGATTTTGGTCTTTCTAGACTTGGGATGACAGAATCATCATACATATCAACGGCACCACAAGGGACTCCGGGCTATGTAGATCCTCAATACCATCAAAACTTCCACCTTTCTGATAAAAGTGATGTTTACAGTTTTGGGGTAGTGTTAGTAGAGATAATAACCGCGATGAAGGTGGTTGATTTTGCTCGACCTCAAAGTGAGGTTAATTTGGCTGCACTTGCTATTGATAGGATTGGGAAGGGATGTGTGGATGAGATAGTGGATCCCTTTCTTGAGCCAAACAGGGATGCTTGGACTCTTTACTCAGTTAACAAGGTGGCTGAGCTTGCATTTAGATGCCTTGCTTTTCACAGTGACATGAGGCCTTCTATGATAGAAGTGGCAGAAGAACTAGAGTACGTCCGGCGCAGTGGGTGGGCAACAATGGAGGAAAATATATGCATGGAATCATCTGCAGCATCCTCTTGTTCATCGCCATATAACGGAAGCGAGAAGTCATTGGGAGGTGTGATGACTAAGAAGGCCGGTATACGAAGCCAAAGATCAATTGCTTCACTAAGGGTGGATAGTTCTCTAGCTACCATGGAGGAGGACAACGACAAGGATAGCTCCCCTGTTTCTGTACATGATCCTTGGTTAAGTGAACAGAGTTCACCTTCAACAAACAGCTTATTGGGTAATGTAGTTCACTGA


Protein sequences

Name Description Sequence
ppa002163m Protein kinase superfamily protein (best arabidopsis hit)

MVLHQKSLTFIIIITILVTTTSIATIARAQNSSSCNPTCGSGKSAKSVQYPFGFSKGCVIPLNCSDKNEIKLGEFTVQDVTRSSIFVHLPAKCNRKYQSIAPLFGLNFGPSWNNSLLFQNCTSPLPGCQIPAEFVQKRFNLSSCDNITCMSQPPNGSDIMTFEDLNRTRCKYLFGSFSVQSGRDSLLSLEFETLQLGWWVNTSLGECHSNAMSTTVKPGGGKPPGCRCSCNAGFDGDGFKLGSGCQPVSQPVSHCNASKYMSGRCGGTTRVAVLIGGFVAGAFLMAGLFLLCYFVRRRSTCLRNQLCARRLLSEAAGNSSVPLYPYKEIERATNCFAEKQRLGTGAFGIVYAGKLHNDEWVAIKKINRRDTNSIDQVMNEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRERGQGLPWTIRLTIAAETANAIAYLHSAMNPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGMTESSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEVNLAALAIDRIGKGCVDEIVDPFLEPNRDAWTLYSVNKVAELAFRCLAFHSDMRPSMIEVAEELEYVRRSGWATMEENICMESSAASSCSSPYNGSEKSLGGVMTKKAGIRSQRSIASLRVDSSLATMEEDNDKDSSPVSVHDPWLSEQSSPSTNSLLGNVVH*

Domains

Domain Start-End Description Sequence

Seg: seg
9-26 seg

TFIIIITILVTTTSIATI

Seg: seg
217-225 seg

KPGGGKPPG

HMMPanther: PTHR24420
221-692 FAMILY NOT NAMED,FAMILY NOT NAMED

GKPPGCRCSCNAGFDGDGFKLGSGCQPVSQPVSHCNASKYMSGRCGGTTRVAVLIGGFVAGAFLMAGLFLLCYFVRRRSTCLRNQLCARRLLSEAAGNSSVPLYPYKEIERATNCFAEKQRLGTGAFGIVYAGKLHNDEWVAIKKINRRDTNSIDQVMNEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRERGQGLPWTIRLTIAAETANAIAYLHSAMNPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGMTESSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEVNLAALAIDRIGKGCVDEIVDPFLEPNRDAWTLYSVNKVAELAFRCLAFHSDMRPSMIEVAEELEYVRRSGWATMEENICMESSAASSCSSPYNGSEKSLGGVMTKKAGIRSQRSIASLRVDSSLATMEEDNDKDSSPVSVHDPWLSE

HMMPanther: PTHR24420:SF852
221-692 SUBFAMILY NOT NAMED

GKPPGCRCSCNAGFDGDGFKLGSGCQPVSQPVSHCNASKYMSGRCGGTTRVAVLIGGFVAGAFLMAGLFLLCYFVRRRSTCLRNQLCARRLLSEAAGNSSVPLYPYKEIERATNCFAEKQRLGTGAFGIVYAGKLHNDEWVAIKKINRRDTNSIDQVMNEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRERGQGLPWTIRLTIAAETANAIAYLHSAMNPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGMTESSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEVNLAALAIDRIGKGCVDEIVDPFLEPNRDAWTLYSVNKVAELAFRCLAFHSDMRPSMIEVAEELEYVRRSGWATMEENICMESSAASSCSSPYNGSEKSLGGVMTKKAGIRSQRSIASLRVDSSLATMEEDNDKDSSPVSVHDPWLSE

Seg: seg
276-291 seg

GGFVAGAFLMAGLFLL

Gene3D: G3DSA:3.30.200.20
318-397 no description

NSSVPLYPYKEIERATNCFAEKQRLGTGAFGIVYAGKLHNDEWVAIKKINRRDTNSIDQVMNEIKLLSSVSHPNLVRLLG

superfamily: SSF56112
IPR011009
322-606 Protein kinase-like (PK-like)
Protein kinase-like domain

PLYPYKEIERATNCFAEKQRLGTGAFGIVYAGKLHNDEWVAIKKINRRDTNSIDQVMNEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRERGQGLPWTIRLTIAAETANAIAYLHSAMNPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGMTESSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEVNLAALAIDRIGKGCVDEIVDPFLEPNRDAWTLYSVNKVAELAFRCLAFHSDMRPSMIEVAE

HMMSmart: SM00220
IPR002290
336-611 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FAEKQRLGTGAFGIVYAGKLHNDEWVAIKKINRRDTNSIDQVMNEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRERGQGLPWTIRLTIAAETANAIAYLHSAMNPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGMTESSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEVNLAALAIDRIGKGCVDEIVDPFLEPNRDAWTLYSVNKVAELAFRCLAFHSDMRPSMIEVAEELEYV

HMMSmart: SM00219
IPR020635
336-608 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FAEKQRLGTGAFGIVYAGKLHNDEWVAIKKINRRDTNSIDQVMNEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRERGQGLPWTIRLTIAAETANAIAYLHSAMNPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGMTESSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEVNLAALAIDRIGKGCVDEIVDPFLEPNRDAWTLYSVNKVAELAFRCLAFHSDMRPSMIEVAEEL

ProfileScan: PS50011
IPR000719
336-611 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAEKQRLGTGAFGIVYAGKLHNDEWVAIKKINRRDTNSIDQVMNEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRERGQGLPWTIRLTIAAETANAIAYLHSAMNPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGMTESSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEVNLAALAIDRIGKGCVDEIVDPFLEPNRDAWTLYSVNKVAELAFRCLAFHSDMRPSMIEVAEELEYV

HMMPfam: PF00069
IPR000719
338-604 Pkinase,Ser-thr
Protein kinase, catalytic domain

EKQRLGTGAFGIVYAGKLHNDEWVAIKKINRRDTNSIDQVMNEIKLLSSVSHPNLVRLLGCCIEGGEQILVYEYMPNGTLSEHLQRERGQGLPWTIRLTIAAETANAIAYLHSAMNPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGMTESSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEVNLAALAIDRIGKGCVDEIVDPFLEPNRDAWTLYSVNKVAELAFRCLAFHSDMRPSMIEV

PatternScan: PS00107
IPR017441
342-365 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGTGAFGIVYAGKLHNDEWVAIKK

Gene3D: G3DSA:1.10.510.10
398-606 no description

CCIEGGEQILVYEYMPNGTLSEHLQRERGQGLPWTIRLTIAAETANAIAYLHSAMNPPIYHRDIKSSNILLDYNYKSKVADFGLSRLGMTESSYISTAPQGTPGYVDPQYHQNFHLSDKSDVYSFGVVLVEIITAMKVVDFARPQSEVNLAALAIDRIGKGCVDEIVDPFLEPNRDAWTLYSVNKVAELAFRCLAFHSDMRPSMIEVAE

PatternScan: PS00108
IPR008271
456-468 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IYHRDIKSSNILL

Seg: seg
627-635 seg

SSAASSCSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox