PRGDB00172444 (ppa024127m)

From PRG Wiki
Jump to: navigation, search
ppa024127m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

S-locus lectin protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGAAGAGACTTTCTTTGAATTGGATAAAAAGCCAGTGGAAACACCATGACATTCATGTTTCATGGACTCTATTGGCTTCGAGTTCAAGTGACATCTGTGACAATTATGGCCGTTGTGGCCCCTATGGAATGTGTGACATTAGCAACTCAGAAGTTTGCAGCTGTTTAAAAGGGTTTCAACCCAAAGATCCTGGAAATTGGAAGTATGCAGACAACTCAGGAGGTTGTGAGCGTATTACACCATTCGTGTGCCAAAATGGAGACGGGTTTGAGAAATATGGTGGGGTGAAGCTGCCAGATACAACACATTCTTGGGTCAACCAAAGTATGAGCCTCAAAGAATGCAGGGCAAGTTGCTTGAACAGCTGTTCTTGTACGGCTTATGCAATCTCTAATGTCAAAGGGGGCAGTAGCTGCACTATCTGGTTTGGTGATCTTATCAGCCTTAGGAAGCTTCTTGATGAAGGGCAGGATCTATATGTTCGAATGCCTGCTTCGGAATCAGAGAAACTGCGGAAAGATGGAATGATGGGTCAGAACAATGAAGGACAGAAGGAAGACCTGGAGCTACCATCCTTTAGCTTGCCAACATTAATCACAGCCACTGATAACTTTTCGTTCAACATGAAGCTTGGAGAAGGTGGTTTTGGATCCGTGTACAAGGGTAGACTAGTAGATGGGCAAGAGATTGCAGTGAAGAGGCTCTCCCAAAGTTCTAGGCAAGGAATCGCCGAATTCAAAAATGAAGTTATACTAATAGCCAAGCTTCAGCACCGAAATCTTGTAAAGCTTCTTGGCTACTGCATTCAGGGAGAAGAAAGATTGCTCATTTATGAATATATGCCCAACAAAAGCTTGGACTTCTACATTTTTGATCAAAATCAAGGTAGACTGTTAGATTGGTCTCAACGCTTCCCCATTATCTGTGGGATTGCAAGGGGTCTTCTCTATCTGCATCAAGATTCCAGACTGAGGATTATTCATAGAGATCTTAAAGCAAGCAATGTGTTACTTGATAAAGAGATGAACCCAAAAATCTCAGACTTTGGCATGGCTAGAATATTTGGAGGAGATCAGACTGAAGGAGTTACAAAGAAAGTTGTTGGAACCTATGGTTATATGGCACCAGAATACGCCATTGATGGTCAATTCTCCGTAAAATCCGATGTTTTTAGCTTTGGTGTTTTATTGTTGGAGACACTAAGTGGAAAGAGAAGTAGAGGGTTTTATGATCGAAATCACAACCTCAACCTCATTGGACATGCATGGCGATTATGGAAAGAGGGAAGGTCCTTAGAGATGATTGATAAATGCTTAAGTGATTCGTGCACTCTCTCAGAAGTCTTGCGTTGCATACATGTTAGTCTTTTATGTGTGCAACAGCTTCCTGAAGACAGGCCAACCATGTCAACTGTGGTTCTGATGTTAGGTGGTGAGAGCGCCTTGCCTCAACCCAAAAAACCAGCTTTCTTTTTAGGAAAACATCCATCCTCCGAAGCAGGTTCTTCTTCAAGTAAGAACCAAACGTCCTCAACTTTCGGTGTGAGAAACGAAACATCTTCAACTAATGAATCTTCGATAACAGTGTTGGAGCCTCGATAA


Protein sequences

Name Description Sequence
ppa024127m S-locus lectin protein kinase family protein (best arabidopsis hit)

MKRLSLNWIKSQWKHHDIHVSWTLLASSSSDICDNYGRCGPYGMCDISNSEVCSCLKGFQPKDPGNWKYADNSGGCERITPFVCQNGDGFEKYGGVKLPDTTHSWVNQSMSLKECRASCLNSCSCTAYAISNVKGGSSCTIWFGDLISLRKLLDEGQDLYVRMPASESEKLRKDGMMGQNNEGQKEDLELPSFSLPTLITATDNFSFNMKLGEGGFGSVYKGRLVDGQEIAVKRLSQSSRQGIAEFKNEVILIAKLQHRNLVKLLGYCIQGEERLLIYEYMPNKSLDFYIFDQNQGRLLDWSQRFPIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDQTEGVTKKVVGTYGYMAPEYAIDGQFSVKSDVFSFGVLLLETLSGKRSRGFYDRNHNLNLIGHAWRLWKEGRSLEMIDKCLSDSCTLSEVLRCIHVSLLCVQQLPEDRPTMSTVVLMLGGESALPQPKKPAFFLGKHPSSEAGSSSSKNQTSSTFGVRNETSSTNESSITVLEPR*

Domains

Domain Start-End Description Sequence

HMMPfam: PF00954
IPR000858
16-62 S_locus_glycop
S-locus glycoprotein

HDIHVSWTLLASSSSDICDNYGRCGPYGMCDISNSEVCSCLKGFQPK

HMMPanther: PTHR24420:SF703
22-531 SUBFAMILY NOT NAMED

WTLLASSSSDICDNYGRCGPYGMCDISNSEVCSCLKGFQPKDPGNWKYADNSGGCERITPFVCQNGDGFEKYGGVKLPDTTHSWVNQSMSLKECRASCLNSCSCTAYAISNVKGGSSCTIWFGDLISLRKLLDEGQDLYVRMPASESEKLRKDGMMGQNNEGQKEDLELPSFSLPTLITATDNFSFNMKLGEGGFGSVYKGRLVDGQEIAVKRLSQSSRQGIAEFKNEVILIAKLQHRNLVKLLGYCIQGEERLLIYEYMPNKSLDFYIFDQNQGRLLDWSQRFPIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDQTEGVTKKVVGTYGYMAPEYAIDGQFSVKSDVFSFGVLLLETLSGKRSRGFYDRNHNLNLIGHAWRLWKEGRSLEMIDKCLSDSCTLSEVLRCIHVSLLCVQQLPEDRPTMSTVVLMLGGESALPQPKKPAFFLGKHPSSEAGSSSSKNQTSSTFGVRNETSSTNESSITVLE

HMMPanther: PTHR24420
22-531 FAMILY NOT NAMED,FAMILY NOT NAMED

WTLLASSSSDICDNYGRCGPYGMCDISNSEVCSCLKGFQPKDPGNWKYADNSGGCERITPFVCQNGDGFEKYGGVKLPDTTHSWVNQSMSLKECRASCLNSCSCTAYAISNVKGGSSCTIWFGDLISLRKLLDEGQDLYVRMPASESEKLRKDGMMGQNNEGQKEDLELPSFSLPTLITATDNFSFNMKLGEGGFGSVYKGRLVDGQEIAVKRLSQSSRQGIAEFKNEVILIAKLQHRNLVKLLGYCIQGEERLLIYEYMPNKSLDFYIFDQNQGRLLDWSQRFPIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDQTEGVTKKVVGTYGYMAPEYAIDGQFSVKSDVFSFGVLLLETLSGKRSRGFYDRNHNLNLIGHAWRLWKEGRSLEMIDKCLSDSCTLSEVLRCIHVSLLCVQQLPEDRPTMSTVVLMLGGESALPQPKKPAFFLGKHPSSEAGSSSSKNQTSSTFGVRNETSSTNESSITVLE

HMMPfam: PF08276
IPR013227
84-148 PAN_2
PAN-2 domain

CQNGDGFEKYGGVKLPDTTHSWVNQSMSLKECRASCLNSCSCTAYAISNVKGGSSCTIWFGDLIS

ProfileScan: PS50948
IPR003609
84-164 PAN
Apple-like

CQNGDGFEKYGGVKLPDTTHSWVNQSMSLKECRASCLNSCSCTAYAISNVKGGSSCTIWFGDLISLRKLLDEGQDLYVRMP

HMMSmart: SM00473
IPR003609
85-163 divergent subfamily of APPLE domains
Apple-like

QNGDGFEKYGGVKLPDTTHSWVNQSMSLKECRASCLNSCSCTAYAISNVKGGSSCTIWFGDLISLRKLLDEGQDLYVRM

superfamily: SSF56112
IPR011009
175-476 Protein kinase-like (PK-like)
Protein kinase-like domain

GMMGQNNEGQKEDLELPSFSLPTLITATDNFSFNMKLGEGGFGSVYKGRLVDGQEIAVKRLSQSSRQGIAEFKNEVILIAKLQHRNLVKLLGYCIQGEERLLIYEYMPNKSLDFYIFDQNQGRLLDWSQRFPIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDQTEGVTKKVVGTYGYMAPEYAIDGQFSVKSDVFSFGVLLLETLSGKRSRGFYDRNHNLNLIGHAWRLWKEGRSLEMIDKCLSDSCTLSEVLRCIHVSLLCVQQLPEDRPTMSTVVLML

Gene3D: G3DSA:3.30.200.20
189-267 no description

ELPSFSLPTLITATDNFSFNMKLGEGGFGSVYKGRLVDGQEIAVKRLSQSSRQGIAEFKNEVILIAKLQHRNLVKLLGY

HMMSmart: SM00219
IPR020635
205-476 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSFNMKLGEGGFGSVYKGRLVDGQEIAVKRLSQSSRQGIAEFKNEVILIAKLQHRNLVKLLGYCIQGEERLLIYEYMPNKSLDFYIFDQNQGRLLDWSQRFPIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDQTEGVTKKVVGTYGYMAPEYAIDGQFSVKSDVFSFGVLLLETLSGKRSRGFYDRNHNLNLIGHAWRLWKEGRSLEMIDKCLSDSCTLSEVLRCIHVSLLCVQQLPEDRPTMSTVVLML

ProfileScan: PS50011
IPR000719
205-482 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSFNMKLGEGGFGSVYKGRLVDGQEIAVKRLSQSSRQGIAEFKNEVILIAKLQHRNLVKLLGYCIQGEERLLIYEYMPNKSLDFYIFDQNQGRLLDWSQRFPIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDQTEGVTKKVVGTYGYMAPEYAIDGQFSVKSDVFSFGVLLLETLSGKRSRGFYDRNHNLNLIGHAWRLWKEGRSLEMIDKCLSDSCTLSEVLRCIHVSLLCVQQLPEDRPTMSTVVLMLGGESAL

HMMSmart: SM00220
IPR002290
205-456 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSFNMKLGEGGFGSVYKGRLVDGQEIAVKRLSQSSRQGIAEFKNEVILIAKLQHRNLVKLLGYCIQGEERLLIYEYMPNKSLDFYIFDQNQGRLLDWSQRFPIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDQTEGVTKKVVGTYGYMAPEYAIDGQFSVKSDVFSFGVLLLETLSGKRSRGFYDRNHNLNLIGHAWRLWKEGRSLEMIDKCLSDSCTLSEVLRCIHVSL

HMMPfam: PF07714
IPR001245
206-475 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SFNMKLGEGGFGSVYKGRLVDGQEIAVKRLSQSSRQGIAEFKNEVILIAKLQHRNLVKLLGYCIQGEERLLIYEYMPNKSLDFYIFDQNQGRLLDWSQRFPIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDQTEGVTKKVVGTYGYMAPEYAIDGQFSVKSDVFSFGVLLLETLSGKRSRGFYDRNHNLNLIGHAWRLWKEGRSLEMIDKCLSDSCTLSEVLRCIHVSLLCVQQLPEDRPTMSTVVLM

PatternScan: PS00107
IPR017441
211-233 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGSVYKGRLVDGQEIAVK

Gene3D: G3DSA:1.10.510.10
268-473 no description

CIQGEERLLIYEYMPNKSLDFYIFDQNQGRLLDWSQRFPIICGIARGLLYLHQDSRLRIIHRDLKASNVLLDKEMNPKISDFGMARIFGGDQTEGVTKKVVGTYGYMAPEYAIDGQFSVKSDVFSFGVLLLETLSGKRSRGFYDRNHNLNLIGHAWRLWKEGRSLEMIDKCLSDSCTLSEVLRCIHVSLLCVQQLPEDRPTMSTVV

PatternScan: PS00108
IPR008271
326-338 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNVLL

Seg: seg
502-511 seg

SSSSKNQTSS

Seg: seg
517-526 seg

NETSSTNESS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox