PRGDB00172450 (ppa002452m)

From PRG Wiki
Jump to: navigation, search
ppa002452m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

leucine-rich repeat transmembrane protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGCAGCCATAGCCACACTTCTAATATTCACGCACTTGTTTTTAACCGTTCTACATGCCTCATCAAACCCAGATTTCGAGCATTTACTAGCATTCAAATCCTCCTCTGACGCATCCAACAAGCTAGCCACCTGGAACTCAAGCTCCGACCTGTGCACCTGGTTCGGCGTCTCCTGCACCCGAAACCGAGTCTCGCGACTGGTCCTCGAAAACCTGGACCTCCACGGCTCGTTCGAGTCCCTAACCGATTTAACTCAGCTCCGAGTTCTCAGCCTCAAGCGGAACCGTCTCTCCGGCCCCATTCCCGACCTCTCAAACCTCACCGCTCTCAAGCTTCTCTTCCTCTCATACAACGACTTCTCCGGCGACTTTCCCGCCTCTGTCACCTCTCTCTTCAGACTCTACCGACTCGATCTATCCTACAACAACTTGTCCGGCCACATTCCCTCCACGGTCAACTATTTGACCCATCTTCTCACTCTCCGGCTTGAGGTCAATCGGTTCGCAGGTTCGATTTCCGGCTTGAACCTCCCGAATCTGCAGGATTTTAATGTGTCTGCAAACCGTTTGACCGGCGAAATACCGAAGTCCTTTTCAGGTTTTCCCGAATCCGCTTTCGCTCAAAACCCGGGTCTATGCGGGTCTCCGGTGCTGAACTGCAAGGGCCTAGTGAACAACCCGACTCGGCCCGGATTTGATGGAGCTATCGCTTCTCCTGTAATGCCGGCTGCTAATCCAACAGTAGTAGCCTCGTCTCCGAGTTCACTGCCGGGAAACTCAACGCCGAACAAATCGACAAATACTCGCCGCAATGGAACATCGAAAATAAGTCCAGAGGCTCTCATCGCGATTATAGTCGGCGACGCTCTGGTTCTTGTTTTTGTTTCACTGCTCCTATACTGCTATTTCTTGCGGAACTTCAGCGCCAAAATGCGGCAGGGCAAGAGCAGCTCGAAGCTTCTAGAAAGCGAGAAGATAGTATACTCTTCAAGCCCGTACTCGGCCCAACCCGGGATCGAGCGGGGTCAGATGGTGTTTTTCGAGGGGGTGAAGCGGTTCGAGCTCGAGGACTTGCTCAGAGCCTCGGCGGAGATGTTGGGTAAAGGCGGGTTCGGAACGGCATACAAGGCGGTTCTGGACGACGGCAATGTGGTGGCGGTGAAGAGGCTCAAGGATGCGCAGATTGGTGGGAAGCGAGAGTTCGAGCAGCACATGGCCGTGTTGGGGCGGCTCAGCCATCCCAATATTGTTAGTTTGAGAGCTTATTATTTTGCCAGGGAGGAGAAGTTGCTGGTCTACGATTACATGTCGAATGGTAACTTATTTTGGCTGCTTCACGGAAACCGGGGCCCCGGTCGAACCCCACTGGACTGGACCACGAGGCTGAAAATCGCAGCGGGAGCGGCTCGAGGCCTAGCTTGTATTCACAACTCGTGCAGTCCGCTAAAGCTCACCCACGGTAACATCAAATCCACCAACATCCTATTAGACAAGACCGGCAATGCTCGTGTCTCCGACTTCGGACTCTCCGTGTTTGTACCTCCTCCCCCAGCCACGTCGTCCGCTCCACGATCCTGCGGCTACCGCGCTCCCGAGACGTTGGACGGTCGAAAATTAACGCAGAAATCCGATGTGTACGCTTTCGGTGTGCTTCTGCTGGAGCTGCTCACAGGGAAGTGCCCCTCCGTCGTGGACAGTGGTGGGCCTGGGGGTGGTTATGGTGGGCTTGTGGACCTGCCCAGGTGGGTCCAGTCGGTGGTCAGAGAGGAATGGACGGCGGAGGTGTTTGACCTTGAGCTGATGAGGTACAAGGATATAGAGGAGGAGATGGTGGGGCTTCTGCAGATCGCGATGGCTTGCACCGCCGCTTCGCCTGATCAACGGCCCAGGATGAGCCAGGTGGTGAAAATGATCGACGAGATTCAGGGTGTGGTGGGCTCCCCGAGTCATGAGGCCTTTGACTCCAAGTCCGAGTCGCCTTCCTTGTCGGAGGACACTTGCGGCGCGAGCCAGTAA


Protein sequences

Name Description Sequence
ppa002452m leucine-rich repeat transmembrane protein kinase family protein (best arabidopsis hit)

MAAIATLLIFTHLFLTVLHASSNPDFEHLLAFKSSSDASNKLATWNSSSDLCTWFGVSCTRNRVSRLVLENLDLHGSFESLTDLTQLRVLSLKRNRLSGPIPDLSNLTALKLLFLSYNDFSGDFPASVTSLFRLYRLDLSYNNLSGHIPSTVNYLTHLLTLRLEVNRFAGSISGLNLPNLQDFNVSANRLTGEIPKSFSGFPESAFAQNPGLCGSPVLNCKGLVNNPTRPGFDGAIASPVMPAANPTVVASSPSSLPGNSTPNKSTNTRRNGTSKISPEALIAIIVGDALVLVFVSLLLYCYFLRNFSAKMRQGKSSSKLLESEKIVYSSSPYSAQPGIERGQMVFFEGVKRFELEDLLRASAEMLGKGGFGTAYKAVLDDGNVVAVKRLKDAQIGGKREFEQHMAVLGRLSHPNIVSLRAYYFAREEKLLVYDYMSNGNLFWLLHGNRGPGRTPLDWTTRLKIAAGAARGLACIHNSCSPLKLTHGNIKSTNILLDKTGNARVSDFGLSVFVPPPPATSSAPRSCGYRAPETLDGRKLTQKSDVYAFGVLLLELLTGKCPSVVDSGGPGGGYGGLVDLPRWVQSVVREEWTAEVFDLELMRYKDIEEEMVGLLQIAMACTAASPDQRPRMSQVVKMIDEIQGVVGSPSHEAFDSKSESPSLSEDTCGASQ*

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
19-221 L domain-like,LRR

HASSNPDFEHLLAFKSSSDASNKLATWNSSSDLCTWFGVSCTRNRVSRLVLENLDLHGSFESLTDLTQLRVLSLKRNRLSGPIPDLSNLTALKLLFLSYNDFSGDFPASVTSLFRLYRLDLSYNNLSGHIPSTVNYLTHLLTLRLEVNRFAGSISGLNLPNLQDFNVSANRLTGEIPKSFSGFPESAFAQNPGLCGSPVLNCK

HMMPanther: PTHR24420:SF923
22-667 LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN KINASE, PUTATIVE

SNPDFEHLLAFKSSSDASNKLATWNSSSDLCTWFGVSCTRNRVSRLVLENLDLHGSFESLTDLTQLRVLSLKRNRLSGPIPDLSNLTALKLLFLSYNDFSGDFPASVTSLFRLYRLDLSYNNLSGHIPSTVNYLTHLLTLRLEVNRFAGSISGLNLPNLQDFNVSANRLTGEIPKSFSGFPESAFAQNPGLCGSPVLNCKGLVNNPTRPGFDGAIASPVMPAANPTVVASSPSSLPGNSTPNKSTNTRRNGTSKISPEALIAIIVGDALVLVFVSLLLYCYFLRNFSAKMRQGKSSSKLLESEKIVYSSSPYSAQPGIERGQMVFFEGVKRFELEDLLRASAEMLGKGGFGTAYKAVLDDGNVVAVKRLKDAQIGGKREFEQHMAVLGRLSHPNIVSLRAYYFAREEKLLVYDYMSNGNLFWLLHGNRGPGRTPLDWTTRLKIAAGAARGLACIHNSCSPLKLTHGNIKSTNILLDKTGNARVSDFGLSVFVPPPPATSSAPRSCGYRAPETLDGRKLTQKSDVYAFGVLLLELLTGKCPSVVDSGGPGGGYGGLVDLPRWVQSVVREEWTAEVFDLELMRYKDIEEEMVGLLQIAMACTAASPDQRPRMSQVVKMIDEIQGVVGSPSHEAFDSKSESPSLSEDTC

HMMPanther: PTHR24420
22-667 FAMILY NOT NAMED,FAMILY NOT NAMED

SNPDFEHLLAFKSSSDASNKLATWNSSSDLCTWFGVSCTRNRVSRLVLENLDLHGSFESLTDLTQLRVLSLKRNRLSGPIPDLSNLTALKLLFLSYNDFSGDFPASVTSLFRLYRLDLSYNNLSGHIPSTVNYLTHLLTLRLEVNRFAGSISGLNLPNLQDFNVSANRLTGEIPKSFSGFPESAFAQNPGLCGSPVLNCKGLVNNPTRPGFDGAIASPVMPAANPTVVASSPSSLPGNSTPNKSTNTRRNGTSKISPEALIAIIVGDALVLVFVSLLLYCYFLRNFSAKMRQGKSSSKLLESEKIVYSSSPYSAQPGIERGQMVFFEGVKRFELEDLLRASAEMLGKGGFGTAYKAVLDDGNVVAVKRLKDAQIGGKREFEQHMAVLGRLSHPNIVSLRAYYFAREEKLLVYDYMSNGNLFWLLHGNRGPGRTPLDWTTRLKIAAGAARGLACIHNSCSPLKLTHGNIKSTNILLDKTGNARVSDFGLSVFVPPPPATSSAPRSCGYRAPETLDGRKLTQKSDVYAFGVLLLELLTGKCPSVVDSGGPGGGYGGLVDLPRWVQSVVREEWTAEVFDLELMRYKDIEEEMVGLLQIAMACTAASPDQRPRMSQVVKMIDEIQGVVGSPSHEAFDSKSESPSLSEDTC

HMMPfam: PF08263
IPR013210
23-59 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NPDFEHLLAFKSSSDASNKLATWNSSSDLCTWFGVSC

Gene3D: G3DSA:3.80.10.10
33-201 no description

KSSSDASNKLATWNSSSDLCTWFGVSCTRNRVSRLVLENLDLHGSFESLTDLTQLRVLSLKRNRLSGPIPDLSNLTALKLLFLSYNDFSGDFPASVTSLFRLYRLDLSYNNLSGHIPSTVNYLTHLLTLRLEVNRFAGSISGLNLPNLQDFNVSANRLTGEIPKSFSGF

HMMPfam: PF12799
85-124 LRR_4,Leucine Rich repeats (2 copies)

TQLRVLSLKRNRLSGPIPDLSNLTALKLLFLSYNDFSGDF

ProfileScan: PS51450
IPR001611
86-108 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLRVLSLKRNRLSGPIPDLSNLT

ProfileScan: PS51450
IPR001611
133-155 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLYRLDLSYNNLSGHIPSTVNYL

HMMPfam: PF00560
IPR001611
134-150 LRR_1
Leucine-rich repeat

LYRLDLSYNNLSGHIPS

HMMPfam: PF00560
IPR001611
179-200 LRR_1
Leucine-rich repeat

NLQDFNVSANRLTGEIPKSFSG

Seg: seg
315-325 seg

KSSSKLLESEK

superfamily: SSF56112
IPR011009
328-638 Protein kinase-like (PK-like)
Protein kinase-like domain

YSSSPYSAQPGIERGQMVFFEGVKRFELEDLLRASAEMLGKGGFGTAYKAVLDDGNVVAVKRLKDAQIGGKREFEQHMAVLGRLSHPNIVSLRAYYFAREEKLLVYDYMSNGNLFWLLHGNRGPGRTPLDWTTRLKIAAGAARGLACIHNSCSPLKLTHGNIKSTNILLDKTGNARVSDFGLSVFVPPPPATSSAPRSCGYRAPETLDGRKLTQKSDVYAFGVLLLELLTGKCPSVVDSGGPGGGYGGLVDLPRWVQSVVREEWTAEVFDLELMRYKDIEEEMVGLLQIAMACTAASPDQRPRMSQVVKMI

HMMSmart: SM00219
IPR020635
360-638 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RASAEMLGKGGFGTAYKAVLDDGNVVAVKRLKDAQIGGKREFEQHMAVLGRLSHPNIVSLRAYYFAREEKLLVYDYMSNGNLFWLLHGNRGPGRTPLDWTTRLKIAAGAARGLACIHNSCSPLKLTHGNIKSTNILLDKTGNARVSDFGLSVFVPPPPATSSAPRSCGYRAPETLDGRKLTQKSDVYAFGVLLLELLTGKCPSVVDSGGPGGGYGGLVDLPRWVQSVVREEWTAEVFDLELMRYKDIEEEMVGLLQIAMACTAASPDQRPRMSQVVKMI

ProfileScan: PS50011
IPR000719
360-653 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RASAEMLGKGGFGTAYKAVLDDGNVVAVKRLKDAQIGGKREFEQHMAVLGRLSHPNIVSLRAYYFAREEKLLVYDYMSNGNLFWLLHGNRGPGRTPLDWTTRLKIAAGAARGLACIHNSCSPLKLTHGNIKSTNILLDKTGNARVSDFGLSVFVPPPPATSSAPRSCGYRAPETLDGRKLTQKSDVYAFGVLLLELLTGKCPSVVDSGGPGGGYGGLVDLPRWVQSVVREEWTAEVFDLELMRYKDIEEEMVGLLQIAMACTAASPDQRPRMSQVVKMIDEIQGVVGSPSHEAF

HMMSmart: SM00220
IPR002290
360-638 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RASAEMLGKGGFGTAYKAVLDDGNVVAVKRLKDAQIGGKREFEQHMAVLGRLSHPNIVSLRAYYFAREEKLLVYDYMSNGNLFWLLHGNRGPGRTPLDWTTRLKIAAGAARGLACIHNSCSPLKLTHGNIKSTNILLDKTGNARVSDFGLSVFVPPPPATSSAPRSCGYRAPETLDGRKLTQKSDVYAFGVLLLELLTGKCPSVVDSGGPGGGYGGLVDLPRWVQSVVREEWTAEVFDLELMRYKDIEEEMVGLLQIAMACTAASPDQRPRMSQVVKMI

Gene3D: G3DSA:3.30.200.20
363-421 no description

AEMLGKGGFGTAYKAVLDDGNVVAVKRLKDAQIGGKREFEQHMAVLGRLSHPNIVSLRA

HMMPfam: PF00069
IPR000719
364-562 Pkinase,Ser-thr
Protein kinase, catalytic domain

EMLGKGGFGTAYKAVLDDGNVVAVKRLKDAQIGGKREFEQHMAVLGRLSHPNIVSLRAYYFAREEKLLVYDYMSNGNLFWLLHGNRGPGRTPLDWTTRLKIAAGAARGLACIHNSCSPLKLTHGNIKSTNILLDKTGNARVSDFGLSVFVPPPPATSSAPRSCGYRAPETLDGRKLTQKSDVYAFGVLLLELLTGKCPS

PatternScan: PS00107
IPR017441
366-388 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGGFGTAYKAVLDDGNVVAVK

Gene3D: G3DSA:1.10.510.10
422-636 no description

YYFAREEKLLVYDYMSNGNLFWLLHGNRGPGRTPLDWTTRLKIAAGAARGLACIHNSCSPLKLTHGNIKSTNILLDKTGNARVSDFGLSVFVPPPPATSSAPRSCGYRAPETLDGRKLTQKSDVYAFGVLLLELLTGKCPSVVDSGGPGGGYGGLVDLPRWVQSVVREEWTAEVFDLELMRYKDIEEEMVGLLQIAMACTAASPDQRPRMSQVVK

Seg: seg
514-523 seg

PPPPATSSAP

Seg: seg
567-575 seg

GGPGGGYGG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox