PRGDB00172456 (ppa006497m)

From PRG Wiki
Jump to: navigation, search
ppa006497m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

shaggy-like kinase 13 (best arabidopsis hit)

DNA Sequence

ATGGCTTCAGCTGGTACAGCAGCTGCTCCGGCTGCTGAAAATCCTAGTGGCAACACAAAGTTTGCTGATAAGCTCCCAGAGGAAATTAATGAAATGAAGATCAAAGATGAGAAGGAAATGGAAACAGCTGTGGTGAATGGCAATGGAACTGAAACTGGCCACATTATTGTAACTACGATCGGGGGTCGAAATGGTCAGCCTAAACAGACCATAAGTTACATGGCAGAGCGTGTTGTTGGGCAAGGGTCATTTGGTATTGTATTTCAGGCTAAATGCCTAGAAACTGGAGAAACTGTTGCAATCAAGAAGGTTTTGCAGGACAAGAGATACAAGAACCGAGAGTTGCAAACAATGCGTCTGCTTGACCATCCTAATGTTGTGTCACTCAAACATTGTTTCTTTTCAACCACGGATAAGGATGAGCTCTATCTGAATCTTGTGCTTGAATATGTACCTGAGACTGTTTATCGTGTGTCAAAACACTATAGCAAAGCCAATCAGCGGATGCCTCTGATATATGTCAAACTCTATACATATCAGATTTGTAGAGCTCTGGCATATATTCATGGAGGGATAGGTGTATGCCACAGAGACATTAAGCCGCAGAATCTCTTGGTTAATCCCCATACTCATCAGGTTAAGCTGTGTGATTTTGGAAGTGCAAAAGTCCTGGTCAAAGGCGAGCCAAATATATCATATATTTGTTCTCGTTATTATCGAGCACCTGAGCTTATATTTGGGGCAACTGAATACACTACTGCCATTGACATATGGTCTGTGGGTTGTGTTCTTGCTGAACTGCTTCTTGGACAGCCCCTGTTCCCAGGTGAAAGTGGAGTTGATCAGCTTGTTGAGATTATTAAGGTACTGGGAACGCCAACTCGTGAGGAAATCAAATGTATGAACCCGAATTATACAGAATTCAAATTCCCACAAATCAAGGCTCACCCTTGGCACAAAATATTCCACAAGCGCATGCCCCCAGAAGCAGTAGATCTTGTGTCAAGACTACTTCAGTATTCTCCAAGTCTAAGATGCACTGCTCTCGAGGCCTGTGTCCACCCATTTTTTGATCAACTCCGTGATCCTAATGCTCGTCTCCCTAATGGGCGCCCTTTGCCTCCTCTATTCAACTTCAAGCCTCAAGAGCTGAAGGGAGCAACTTTTGAGCTTCTGTCCAGACTGATACCTGAGCATGCCCGAAAACAATGTGCTTTTCTAGGTATCTAG


Protein sequences

Name Description Sequence
ppa006497m shaggy-like kinase 13 (best arabidopsis hit)

MASAGTAAAPAAENPSGNTKFADKLPEEINEMKIKDEKEMETAVVNGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPETVYRVSKHYSKANQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVHPFFDQLRDPNARLPNGRPLPPLFNFKPQELKGATFELLSRLIPEHARKQCAFLGI*

Domains

Domain Start-End Description Sequence

Seg: seg
2-18 seg

ASAGTAAAPAAENPSGN

HMMPanther: PTHR24057
22-406 FAMILY NOT NAMED,GLYCOGEN SYNTHASE KINASE-3 ALPHA

ADKLPEEINEMKIKDEKEMETAVVNGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPETVYRVSKHYSKANQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVHPFFDQLRDPNARLPNGRPLPPLFNFKPQELKGATFELLSRLIPEHARKQCAF

Gene3D: G3DSA:3.30.200.20
67-148 no description

PKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVL

superfamily: SSF56112
IPR011009
72-388 Protein kinase-like (PK-like)
Protein kinase-like domain

SYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPETVYRVSKHYSKANQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVHPFFDQLRDPNARLPNGRPLPPLFNFKPQELKGAT

HMMSmart: SM00220
IPR002290
73-357 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPETVYRVSKHYSKANQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVHPFF

ProfileScan: PS50011
IPR000719
73-357 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPETVYRVSKHYSKANQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVHPFF

HMMSmart: SM00219
IPR020635
73-357 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPETVYRVSKHYSKANQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVHPFF

HMMPfam: PF00069
IPR000719
76-357 Pkinase,Ser-thr
Protein kinase, catalytic domain

ERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPETVYRVSKHYSKANQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVHPFF

PatternScan: PS00107
IPR017441
79-103 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGQGSFGIVFQAKCLETGETVAIKK

Gene3D: G3DSA:1.10.510.10
149-364 no description

EYVPETVYRVSKHYSKANQRMPLIYVKLYTYQICRALAYIHGGIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSVGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVHPFFDQLRDPN

PatternScan: PS00108
IPR008271
194-206 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VCHRDIKPQNLLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox