PRGDB00172461 (ppa017599m)

From PRG Wiki
Jump to: navigation, search
ppa017599m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat receptor-like protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGACATCTTTCACTTACGCTAAACTTTGCTTCCTCCCTTATTGCCTTGTCATCTTCTTGTTTGTTTCATCACCAAATTGGGTTGCTTTTCCTTCTGCTACTTCTACTTCTCATACTGAGGCAGAGGCTCTTCTCAAATGGAAAGCCAGCTTCTTTCCAAATCAAGCCCTCAATAACCTCACCTGGTACGACCTTCCCACTCATAATATTAATGCCACCAATTCTTCCAGCACCAATCCAAAACCAAGAACAAGCCCATGCACTTGGACTGGTGTTTCATGCAACTCAGCTAGAAGTGTCAACAAGATAGAGCTTTTTTCATTCTTGTCCTTCCCTAATCTTGAATATCTTAACCTCAGTCTGAACAAACTCTTTGATGCCATCCCACCTCAAATCAGTAACCTCTCCAAACTCCACTATCTTGATCTCTCTTGGAATAACTTTTCTGGGAGAATTCCACCAGAAATTGGTCTCTTAAGAAATCTTACCTATCTTTATCTCTATGATAATAAACTTTCTGGTTTGATTCCCAAGGAGATAGGGAACTTGAAATCTCTTGTATATCTAGCATTGTCCTCCAACAATTTAAGTGGTCTCATCCCTCCAAATATTGGTAACTTAATAAACCTAAACACTTTGTACTTGTATTCCAATCAACTTTCTGGTTTGATTCCCAAGGAGATAGGGAACTTGAAATCTCTTGTAAATCTATCGTTGTCCTACAATAATTTAACTGGTGTCATCCCTCCAAATATTGGTAACTTAATAAACCTAAACACTTTGCACTTGTATTCCAATCAACTTTCTGGTTTGATTCCCAAGGAGATAGGGAACTTGAAATCTCTAAACACTTTGCACTTGTATTCCAATCAACTTTCTGGTTTGATTCCCAAGGAGATAGGGAACTTGAAATCTCTTATAAAACTAAATTTGGGTAAGAATCAACTCAATGGTTCACTTCCCGTTTCAATCGGTGAGTTGCGCAACTTGGAAAACTTCCACCTAGCTGATAACCAACTTTCCGGCCCTATACCCCAAGAGATAGAGAATCTCAAGAAGTTGACTAATTTGCAGTTGAGTATAAACCAATTTTCTGGTTATTTGCCCCACAATATTTGCCAAGGCGGAAAACTCACAAACTTTACAGTATTCAGAAACCATTTGACTGGTCCAATCCCCAAAAGCTTGAAAAACTGCACGAGCTTATTCAGACTTCGTCTTGACCAGAACCAATTCACAGGCAATATATCTGAAGACTTTGGCATTTATCCGAATCTTCATTTTATGGATGTAAGCCATAACAACTTTTATGGAGAGATCTCACACAATTGGCAAAAAAGCCCAAAGTTGACAACCCTACGACTTGCGGGAAACAACCTAACTGGGAGCATCCCACCTGAGATAGGCAATGCAACCCAAATTCAAGAGCTAGATCTCTCTTCAAATCATTTAGTTGGGTTGATTCCAATGGGATTTGGAAGACTGACTTTTTTGGAGAGGTTGATGTTGAATGGAAATCAACTTTTAGGTCGTATACCCTCTGAATTCGGATCATTGACTGATCTTGATTATCTTGACTTGTCAACAAATAAATTCAGTGACTCAATTCCCAGCATTCTAGGTGACTTGCTCAAATTATACCATCTGAATTTGAGCAACAACAAGTTATCTCAAGCAATTCCACTTCAGTTGGGGAAGTTAGTTCAATTGAACGAGCTGGATTTAAGTCATAACTCTCTTGAAGGTAGCATACCATCAGCAATAAGCAATATGGAGAGTTTGATGATTCTCAATCTTTCCCACAACAATCTTTCGGGTTCCATACCATCAAGTTTCGAAGAGATGCATGGCTTGTCGTACGTTGACATATCCTACAATCACTTGGAAGGTCCCCTTCCCAACATCAAGGCATTTCAAGAAGCTCCGCCAGAAAGATTGGAAGGGAACAAAGGATTGTGTGGCAAAGTTGGAGCTCTGCTACCACCCTGCAATGCACATGGCTCAAAAAAGGACCACAAGGTCATATCTGTTCTAGCAGTATTTGTACTTCTATCTGCTCTCTTTATAATTGTCTTTGTAATAATGCAAAGAAGGAAGAAGCATCAAGATACTAAACAAAACCACATGCATGGAGAAATTTCCTTTTCGGTTTTAAATTTTGATGGAAAATCAATGTATGAGGAAATCATAAGGGCAACAGAAGATTTTGATTCCATATACTGCATTGGGAATGGAGGACATGGAAGCGTCTACAAGGTGAATTTTTCATCTGGAGATGTAGTGGCCGTGAAGAAACTCCATATGCTATGGGATGGCGAGACAAAATTTCAGAAGGAGTTCTTGAATGAAGTAAGGGCACTCAGTGAGATAAGACATCGGAATATTGTGAAGCTCTATGGTTTCTGCGCACATAAACGACACTCGTTTTTGGTGTATGAGTATCTAGAAAGAGGTAGCTTGGCCGCAATGTTGAGCAAAAATGAAGAAGCTAAAGAGTTGGGGTGGAGTAAAAGAGTGAATATTGTTAAAGGCTTAGCTCATGCCTTGTCTTACATGCACCACGATTGCCTGCCACCGATTGTACATCGTGACATCTCAAGCAAGAACATTTTGTTGGATTCTGAATATGAGGCGTGTGTTTCAGACTTTGGCACAGCTAAGTTTTTAAATCCAGACTCAACTAATTGGACTGCCGCTGCAGGCACGTATGGCTACATGGCACCAGAGCTTGCTTACACAATGGAAGTGAATGAGAACTGCGATGTTTATAGCTTTGGTGTGGTCACATTGGAAATAATTATGGGAAAGCATCCTGGAGATCTTTTCTCGTCTTTCTTATCAATCTCTTCATCCTCCTCCTCCTCATCATCATCTGCATTAGCAGCCCATCAAATACCAATTGTGGATGTTTTGGACCAACGCATTTCCCCTCCGACGCATCAAGTTGCAAATGAAGTGGTCTCTCTTGTGAAGATAGCATTTTCATGCTTGAATTCCAGCCCGAAATCTCGTCCAATAATGAAACAAGTTTCTCATTTCCTCTCAAATTCGATGCTGCATTTGTCGAAGCCGATACATATGATGACATGTGGTGAATTGCTTGCTCTTGATCCTTTGGTTACCTGA


Protein sequences

Name Description Sequence
ppa017599m Leucine-rich repeat receptor-like protein kinase family protein (best arabidopsis hit)

MTSFTYAKLCFLPYCLVIFLFVSSPNWVAFPSATSTSHTEAEALLKWKASFFPNQALNNLTWYDLPTHNINATNSSSTNPKPRTSPCTWTGVSCNSARSVNKIELFSFLSFPNLEYLNLSLNKLFDAIPPQISNLSKLHYLDLSWNNFSGRIPPEIGLLRNLTYLYLYDNKLSGLIPKEIGNLKSLVYLALSSNNLSGLIPPNIGNLINLNTLYLYSNQLSGLIPKEIGNLKSLVNLSLSYNNLTGVIPPNIGNLINLNTLHLYSNQLSGLIPKEIGNLKSLNTLHLYSNQLSGLIPKEIGNLKSLIKLNLGKNQLNGSLPVSIGELRNLENFHLADNQLSGPIPQEIENLKKLTNLQLSINQFSGYLPHNICQGGKLTNFTVFRNHLTGPIPKSLKNCTSLFRLRLDQNQFTGNISEDFGIYPNLHFMDVSHNNFYGEISHNWQKSPKLTTLRLAGNNLTGSIPPEIGNATQIQELDLSSNHLVGLIPMGFGRLTFLERLMLNGNQLLGRIPSEFGSLTDLDYLDLSTNKFSDSIPSILGDLLKLYHLNLSNNKLSQAIPLQLGKLVQLNELDLSHNSLEGSIPSAISNMESLMILNLSHNNLSGSIPSSFEEMHGLSYVDISYNHLEGPLPNIKAFQEAPPERLEGNKGLCGKVGALLPPCNAHGSKKDHKVISVLAVFVLLSALFIIVFVIMQRRKKHQDTKQNHMHGEISFSVLNFDGKSMYEEIIRATEDFDSIYCIGNGGHGSVYKVNFSSGDVVAVKKLHMLWDGETKFQKEFLNEVRALSEIRHRNIVKLYGFCAHKRHSFLVYEYLERGSLAAMLSKNEEAKELGWSKRVNIVKGLAHALSYMHHDCLPPIVHRDISSKNILLDSEYEACVSDFGTAKFLNPDSTNWTAAAGTYGYMAPELAYTMEVNENCDVYSFGVVTLEIIMGKHPGDLFSSFLSISSSSSSSSSSALAAHQIPIVDVLDQRISPPTHQVANEVVSLVKIAFSCLNSSPKSRPIMKQVSHFLSNSMLHLSKPIHMMTCGELLALDPLVT*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF472
16-1018 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LVIFLFVSSPNWVAFPSATSTSHTEAEALLKWKASFFPNQALNNLTWYDLPTHNINATNSSSTNPKPRTSPCTWTGVSCNSARSVNKIELFSFLSFPNLEYLNLSLNKLFDAIPPQISNLSKLHYLDLSWNNFSGRIPPEIGLLRNLTYLYLYDNKLSGLIPKEIGNLKSLVYLALSSNNLSGLIPPNIGNLINLNTLYLYSNQLSGLIPKEIGNLKSLVNLSLSYNNLTGVIPPNIGNLINLNTLHLYSNQLSGLIPKEIGNLKSLNTLHLYSNQLSGLIPKEIGNLKSLIKLNLGKNQLNGSLPVSIGELRNLENFHLADNQLSGPIPQEIENLKKLTNLQLSINQFSGYLPHNICQGGKLTNFTVFRNHLTGPIPKSLKNCTSLFRLRLDQNQFTGNISEDFGIYPNLHFMDVSHNNFYGEISHNWQKSPKLTTLRLAGNNLTGSIPPEIGNATQIQELDLSSNHLVGLIPMGFGRLTFLERLMLNGNQLLGRIPSEFGSLTDLDYLDLSTNKFSDSIPSILGDLLKLYHLNLSNNKLSQAIPLQLGKLVQLNELDLSHNSLEGSIPSAISNMESLMILNLSHNNLSGSIPSSFEEMHGLSYVDISYNHLEGPLPNIKAFQEAPPERLEGNKGLCGKVGALLPPCNAHGSKKDHKVISVLAVFVLLSALFIIVFVIMQRRKKHQDTKQNHMHGEISFSVLNFDGKSMYEEIIRATEDFDSIYCIGNGGHGSVYKVNFSSGDVVAVKKLHMLWDGETKFQKEFLNEVRALSEIRHRNIVKLYGFCAHKRHSFLVYEYLERGSLAAMLSKNEEAKELGWSKRVNIVKGLAHALSYMHHDCLPPIVHRDISSKNILLDSEYEACVSDFGTAKFLNPDSTNWTAAAGTYGYMAPELAYTMEVNENCDVYSFGVVTLEIIMGKHPGDLFSSFLSISSSSSSSSSSALAAHQIPIVDVLDQRISPPTHQVANEVVSLVKIAFSCLNSSPKSRPIMKQVSHFLSNSM

HMMPanther: PTHR24420
16-1018 FAMILY NOT NAMED,FAMILY NOT NAMED

LVIFLFVSSPNWVAFPSATSTSHTEAEALLKWKASFFPNQALNNLTWYDLPTHNINATNSSSTNPKPRTSPCTWTGVSCNSARSVNKIELFSFLSFPNLEYLNLSLNKLFDAIPPQISNLSKLHYLDLSWNNFSGRIPPEIGLLRNLTYLYLYDNKLSGLIPKEIGNLKSLVYLALSSNNLSGLIPPNIGNLINLNTLYLYSNQLSGLIPKEIGNLKSLVNLSLSYNNLTGVIPPNIGNLINLNTLHLYSNQLSGLIPKEIGNLKSLNTLHLYSNQLSGLIPKEIGNLKSLIKLNLGKNQLNGSLPVSIGELRNLENFHLADNQLSGPIPQEIENLKKLTNLQLSINQFSGYLPHNICQGGKLTNFTVFRNHLTGPIPKSLKNCTSLFRLRLDQNQFTGNISEDFGIYPNLHFMDVSHNNFYGEISHNWQKSPKLTTLRLAGNNLTGSIPPEIGNATQIQELDLSSNHLVGLIPMGFGRLTFLERLMLNGNQLLGRIPSEFGSLTDLDYLDLSTNKFSDSIPSILGDLLKLYHLNLSNNKLSQAIPLQLGKLVQLNELDLSHNSLEGSIPSAISNMESLMILNLSHNNLSGSIPSSFEEMHGLSYVDISYNHLEGPLPNIKAFQEAPPERLEGNKGLCGKVGALLPPCNAHGSKKDHKVISVLAVFVLLSALFIIVFVIMQRRKKHQDTKQNHMHGEISFSVLNFDGKSMYEEIIRATEDFDSIYCIGNGGHGSVYKVNFSSGDVVAVKKLHMLWDGETKFQKEFLNEVRALSEIRHRNIVKLYGFCAHKRHSFLVYEYLERGSLAAMLSKNEEAKELGWSKRVNIVKGLAHALSYMHHDCLPPIVHRDISSKNILLDSEYEACVSDFGTAKFLNPDSTNWTAAAGTYGYMAPELAYTMEVNENCDVYSFGVVTLEIIMGKHPGDLFSSFLSISSSSSSSSSSALAAHQIPIVDVLDQRISPPTHQVANEVVSLVKIAFSCLNSSPKSRPIMKQVSHFLSNSM

superfamily: SSF52058
78-370 L domain-like,LRR

TNPKPRTSPCTWTGVSCNSARSVNKIELFSFLSFPNLEYLNLSLNKLFDAIPPQISNLSKLHYLDLSWNNFSGRIPPEIGLLRNLTYLYLYDNKLSGLIPKEIGNLKSLVYLALSSNNLSGLIPPNIGNLINLNTLYLYSNQLSGLIPKEIGNLKSLVNLSLSYNNLTGVIPPNIGNLINLNTLHLYSNQLSGLIPKEIGNLKSLNTLHLYSNQLSGLIPKEIGNLKSLIKLNLGKNQLNGSLPVSIGELRNLENFHLADNQLSGPIPQEIENLKKLTNLQLSINQFSGYLPH

Gene3D: G3DSA:3.80.10.10
81-344 no description

KPRTSPCTWTGVSCNSARSVNKIELFSFLSFPNLEYLNLSLNKLFDAIPPQISNLSKLHYLDLSWNNFSGRIPPEIGLLRNLTYLYLYDNKLSGLIPKEIGNLKSLVYLALSSNNLSGLIPPNIGNLINLNTLYLYSNQLSGLIPKEIGNLKSLVNLSLSYNNLTGVIPPNIGNLINLNTLHLYSNQLSGLIPKEIGNLKSLNTLHLYSNQLSGLIPKEIGNLKSLIKLNLGKNQLNGSLPVSIGELRNLENFHLADNQLSGPI

HMMSmart: SM00369
IPR003591
111-134 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FPNLEYLNLSLNKLFDAIPPQISN

HMMSmart: SM00365
111-137 Leucine-rich repeat, SDS22-like subfamily

FPNLEYLNLSLNKLFDAIPPQISNLSK

HMMPfam: PF12799
112-149 LRR_4,Leucine Rich repeats (2 copies)

PNLEYLNLSLNKLFDAIPPQISNLSKLHYLDLSWNNFS

HMMSmart: SM00369
IPR003591
135-158 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSKLHYLDLSWNNFSGRIPPEIGL

HMMPfam: PF13516
159-182 LRR_6,Leucine Rich repeat

LRNLTYLYLYDNKLSGLIPKEIGN

HMMSmart: SM00365
159-185 Leucine-rich repeat, SDS22-like subfamily

LRNLTYLYLYDNKLSGLIPKEIGNLKS

HMMSmart: SM00369
IPR003591
159-182 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRNLTYLYLYDNKLSGLIPKEIGN

HMMSmart: SM00369
IPR003591
183-206 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLVYLALSSNNLSGLIPPNIGN

Seg: seg
198-211 seg

GLIPPNIGNLINLN

HMMSmart: SM00369
IPR003591
207-230 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LINLNTLYLYSNQLSGLIPKEIGN

HMMSmart: SM00365
207-228 Leucine-rich repeat, SDS22-like subfamily

LINLNTLYLYSNQLSGLIPKEI

Seg: seg
230-244 seg

NLKSLVNLSLSYNNL

HMMSmart: SM00365
231-260 Leucine-rich repeat, SDS22-like subfamily

LKSLVNLSLSYNNLTGVIPPNIGNLINLNT

HMMSmart: SM00369
IPR003591
231-254 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLVNLSLSYNNLTGVIPPNIGN

HMMPfam: PF00560
IPR001611
233-255 LRR_1
Leucine-rich repeat

SLVNLSLSYNNLTGVIPPNIGNL

Seg: seg
248-263 seg

IPPNIGNLINLNTLHL

HMMSmart: SM00369
IPR003591
255-278 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LINLNTLHLYSNQLSGLIPKEIGN

HMMSmart: SM00365
279-305 Leucine-rich repeat, SDS22-like subfamily

LKSLNTLHLYSNQLSGLIPKEIGNLKS

HMMSmart: SM00369
IPR003591
279-302 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLNTLHLYSNQLSGLIPKEIGN

HMMSmart: SM00369
IPR003591
303-327 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSLIKLNLGKNQLNGSLPVSIGEL

superfamily: SSF52047
319-629 RNI-like,LRR

SLPVSIGELRNLENFHLADNQLSGPIPQEIENLKKLTNLQLSINQFSGYLPHNICQGGKLTNFTVFRNHLTGPIPKSLKNCTSLFRLRLDQNQFTGNISEDFGIYPNLHFMDVSHNNFYGEISHNWQKSPKLTTLRLAGNNLTGSIPPEIGNATQIQELDLSSNHLVGLIPMGFGRLTFLERLMLNGNQLLGRIPSEFGSLTDLDYLDLSTNKFSDSIPSILGDLLKLYHLNLSNNKLSQAIPLQLGKLVQLNELDLSHNSLEGSIPSAISNMESLMILNLSHNNLSGSIPSSFEEMHGLSYVDISYNHLE

HMMSmart: SM00365
327-353 Leucine-rich repeat, SDS22-like subfamily

LRNLENFHLADNQLSGPIPQEIENLKK

Gene3D: G3DSA:3.80.10.10
345-452 no description

PQEIENLKKLTNLQLSINQFSGYLPHNICQGGKLTNFTVFRNHLTGPIPKSLKNCTSLFRLRLDQNQFTGNISEDFGIYPNLHFMDVSHNNFYGEISHNWQKSPKLTT

HMMSmart: SM00369
IPR003591
351-375 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKKLTNLQLSINQFSGYLPHNICQG

HMMPfam: PF12799
448-484 LRR_4,Leucine Rich repeats (2 copies)

PKLTTLRLAGNNLTGSIPPEIGNATQIQELDLSSNHL

HMMSmart: SM00369
IPR003591
448-471 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

PKLTTLRLAGNNLTGSIPPEIGNA

Gene3D: G3DSA:3.80.10.10
453-634 no description

LRLAGNNLTGSIPPEIGNATQIQELDLSSNHLVGLIPMGFGRLTFLERLMLNGNQLLGRIPSEFGSLTDLDYLDLSTNKFSDSIPSILGDLLKLYHLNLSNNKLSQAIPLQLGKLVQLNELDLSHNSLEGSIPSAISNMESLMILNLSHNNLSGSIPSSFEEMHGLSYVDISYNHLEGPLPN

FPrintScan: PR00019
474-487 LEURICHRPT,Leucine-rich repeat signature

IQELDLSSNHLVGL

HMMSmart: SM00369
IPR003591
495-518 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTFLERLMLNGNQLLGRIPSEFGS

Seg: seg
518-529 seg

SLTDLDYLDLST

HMMSmart: SM00369
IPR003591
519-542 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTDLDYLDLSTNKFSDSIPSILGD

HMMSmart: SM00369
IPR003591
543-566 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LLKLYHLNLSNNKLSQAIPLQLGK

HMMSmart: SM00365
543-564 Leucine-rich repeat, SDS22-like subfamily

LLKLYHLNLSNNKLSQAIPLQL

HMMPfam: PF00560
IPR001611
545-567 LRR_1
Leucine-rich repeat

KLYHLNLSNNKLSQAIPLQLGKL

HMMSmart: SM00369
IPR003591
567-590 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVQLNELDLSHNSLEGSIPSAISN

FPrintScan: PR00019
567-580 LEURICHRPT,Leucine-rich repeat signature

LVQLNELDLSHNSL

HMMSmart: SM00365
567-593 Leucine-rich repeat, SDS22-like subfamily

LVQLNELDLSHNSLEGSIPSAISNMES

HMMPfam: PF13855
569-628 LRR_8,Leucine rich repeat

QLNELDLSHNSLEGSIPSAISNMESLMILNLSHNNLSGSIPSSFEEMHGLSYVDISYNHL

HMMSmart: SM00369
IPR003591
591-614 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MESLMILNLSHNNLSGSIPSSFEE

Seg: seg
674-689 seg

VISVLAVFVLLSALFI

superfamily: SSF56112
IPR011009
706-1014 Protein kinase-like (PK-like)
Protein kinase-like domain

QNHMHGEISFSVLNFDGKSMYEEIIRATEDFDSIYCIGNGGHGSVYKVNFSSGDVVAVKKLHMLWDGETKFQKEFLNEVRALSEIRHRNIVKLYGFCAHKRHSFLVYEYLERGSLAAMLSKNEEAKELGWSKRVNIVKGLAHALSYMHHDCLPPIVHRDISSKNILLDSEYEACVSDFGTAKFLNPDSTNWTAAAGTYGYMAPELAYTMEVNENCDVYSFGVVTLEIIMGKHPGDLFSSFLSISSSSSSSSSSALAAHQIPIVDVLDQRISPPTHQVANEVVSLVKIAFSCLNSSPKSRPIMKQVSHFL

Gene3D: G3DSA:3.30.200.20
726-800 no description

YEEIIRATEDFDSIYCIGNGGHGSVYKVNFSSGDVVAVKKLHMLWDGETKFQKEFLNEVRALSEIRHRNIVKLYG

HMMSmart: SM00220
IPR002290
736-1019 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDSIYCIGNGGHGSVYKVNFSSGDVVAVKKLHMLWDGETKFQKEFLNEVRALSEIRHRNIVKLYGFCAHKRHSFLVYEYLERGSLAAMLSKNEEAKELGWSKRVNIVKGLAHALSYMHHDCLPPIVHRDISSKNILLDSEYEACVSDFGTAKFLNPDSTNWTAAAGTYGYMAPELAYTMEVNENCDVYSFGVVTLEIIMGKHPGDLFSSFLSISSSSSSSSSSALAAHQIPIVDVLDQRISPPTHQVANEVVSLVKIAFSCLNSSPKSRPIMKQVSHFLSNSML

HMMSmart: SM00219
IPR020635
736-1014 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDSIYCIGNGGHGSVYKVNFSSGDVVAVKKLHMLWDGETKFQKEFLNEVRALSEIRHRNIVKLYGFCAHKRHSFLVYEYLERGSLAAMLSKNEEAKELGWSKRVNIVKGLAHALSYMHHDCLPPIVHRDISSKNILLDSEYEACVSDFGTAKFLNPDSTNWTAAAGTYGYMAPELAYTMEVNENCDVYSFGVVTLEIIMGKHPGDLFSSFLSISSSSSSSSSSALAAHQIPIVDVLDQRISPPTHQVANEVVSLVKIAFSCLNSSPKSRPIMKQVSHFL

ProfileScan: PS50011
IPR000719
736-1014 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDSIYCIGNGGHGSVYKVNFSSGDVVAVKKLHMLWDGETKFQKEFLNEVRALSEIRHRNIVKLYGFCAHKRHSFLVYEYLERGSLAAMLSKNEEAKELGWSKRVNIVKGLAHALSYMHHDCLPPIVHRDISSKNILLDSEYEACVSDFGTAKFLNPDSTNWTAAAGTYGYMAPELAYTMEVNENCDVYSFGVVTLEIIMGKHPGDLFSSFLSISSSSSSSSSSALAAHQIPIVDVLDQRISPPTHQVANEVVSLVKIAFSCLNSSPKSRPIMKQVSHFL

HMMPfam: PF00069
IPR000719
741-1011 Pkinase,Ser-thr
Protein kinase, catalytic domain

CIGNGGHGSVYKVNFSSGDVVAVKKLHMLWDGETKFQKEFLNEVRALSEIRHRNIVKLYGFCAHKRHSFLVYEYLERGSLAAMLSKNEEAKELGWSKRVNIVKGLAHALSYMHHDCLPPIVHRDISSKNILLDSEYEACVSDFGTAKFLNPDSTNWTAAAGTYGYMAPELAYTMEVNENCDVYSFGVVTLEIIMGKHPGDLFSSFLSISSSSSSSSSSALAAHQIPIVDVLDQRISPPTHQVANEVVSLVKIAFSCLNSSPKSRPIMKQVS

PatternScan: PS00107
IPR017441
742-765 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGNGGHGSVYKVNFSSGDVVAVKK

Gene3D: G3DSA:1.10.510.10
801-1010 no description

FCAHKRHSFLVYEYLERGSLAAMLSKNEEAKELGWSKRVNIVKGLAHALSYMHHDCLPPIVHRDISSKNILLDSEYEACVSDFGTAKFLNPDSTNWTAAAGTYGYMAPELAYTMEVNENCDVYSFGVVTLEIIMGKHPGDLFSSFLSISSSSSSSSSSALAAHQIPIVDVLDQRISPPTHQVANEVVSLVKIAFSCLNSSPKSRPIMKQV

PatternScan: PS00109
IPR008266
860-872 PROTEIN_KINASE_TYR
Tyrosine-protein kinase, active site

IVHRDISSKNILL

Seg: seg
941-962 seg

LFSSFLSISSSSSSSSSSALAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox