PRGDB00172464 (ppb014730m)

From PRG Wiki
Jump to: navigation, search
ppb014730m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Prunus persica

Comment?

P-loop containing nucleoside triphosphate hydrolases superfamily protein (best arabidopsis hit)

DNA Sequence

AATTGTGTACTTCTTACACCCTCACCTCTGGGTTTTGTGCAGCAGAGAGCTGCAGTTGCTGTTACAAGTTTGAATAAACAACAGAGAGGTGCAGAGAGAGAGAGTACTATGGCTCAAGAAATTGAACATTATCTAATGGAAAAATTCAAGAAAGTTCTTGATGGGAAAGACAAAAGTATCTCCAAAATTCCCAGGTACAACCAATTTCAAGAAATAAAGTCTTTGCTTGTAGACATTTTCAGCTCATTCTCCCCTGTAGATTCATCCATCAGGGACAAGCTTTACTACCTCAACAATGTTGTCACTGAGTGCCAGATGCTAACAAGAAAACACGGTTTCAATTCTCCTGAGGAGCTACTCACCATTAACAGAATCAGAAGGGAGTTAAATAAGATCAAGAGGGAACTCAAGGCTACGAAAGATAAACTACAACCTAACAATGGTGTTTCAAGCTCACAGGACACGGAGACAAGCTCACGGGACACAGGGATTTCGAGGTGGACTACTCATGTAGTAGATGATTCCAAGGTTTATGGATTTGATGATAATGTGGTGTCAATGGAAAAGTTGCTTCTTGAAAAAGAAAGTCATGATCGGTTCAAGGCAGTAGGCATTGTTGGTAGGGAAGGGATAGGCAAAACAACACTTTGCCAATTGATATTCAACAAACCAGAGGTGAAAAACAACTTCCTTCCAAGGATCTGGGTGTGTATGGCCAGACACCCGGATGACAATGAGGATCCAAAACTAGCAATTGTGAAAAGAATGTTGATGCAGCTTGGAGTTGAAAAGAAAATGGTCAGTTTCATTTTTAATGAGAAGCGTGGCCTCGAAGGACTGCTATGTGCTCTTCACCTGCAATTGGTGGGGAAGAGGTATCTGATTGTGCTTGATGATGCTAGGGAGACCGACACATGGTACGGAAAGTTGGATTCTTGTCTGACTAGTGATAAGAAATGGGACGATGGGTTTGCATTCGGATTGCCAAAAGGGAATGGGGGTAGAGTCATAGTCACAAGTAGGAATGAAGAACTAGCAAAGATGATGGTTGGAGAAGAAAATATACATCGCCTTTTGCCGCTTTCAGACCCTGAAAGCTGCTGGAAAATATTCGAAGACGCAGTTGAGAATGATCCGATTCTATTCTATCCTTCAGACTTGGAAGATCTGAAGTTGGAAATCAATCAAAAATGTGGGGGCCTTCCATTAGCAGCAAAAATGATGGGACAGGCAATGCATGAACAAGTTCCGAAGTAA


Protein sequences

Name Description Sequence
ppb014730m P-loop containing nucleoside triphosphate hydrolases superfamily protein (best arabidopsis hit)

NCVLLTPSPLGFVQQRAAVAVTSLNKQQRGAERESTMAQEIEHYLMEKFKKVLDGKDKSISKIPRYNQFQEIKSLLVDIFSSFSPVDSSIRDKLYYLNNVVTECQMLTRKHGFNSPEELLTINRIRRELNKIKRELKATKDKLQPNNGVSSSQDTETSSRDTGISRWTTHVVDDSKVYGFDDNVVSMEKLLLEKESHDRFKAVGIVGREGIGKTTLCQLIFNKPEVKNNFLPRIWVCMARHPDDNEDPKLAIVKRMLMQLGVEKKMVSFIFNEKRGLEGLLCALHLQLVGKRYLIVLDDARETDTWYGKLDSCLTSDKKWDDGFAFGLPKGNGGRVIVTSRNEELAKMMVGEENIHRLLPLSDPESCWKIFEDAVENDPILFYPSDLEDLKLEINQKCGGLPLAAKMMGQAMHEQVPK*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
113-261 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FNSPEELLTINRIRRELNKIKRELKATKDKLQPNNGVSSSQDTETSSRDTGISRWTTHVVDDSKVYGFDDNVVSMEKLLLEKESHDRFKAVGIVGREGIGKTTLCQLIFNKPEVKNNFLPRIWVCMARHPDDNEDPKLAIVKRMLMQLG

Coil: coil
122-143 coiled-coil

INRIRRELNKIKRELKATKDKL

superfamily: SSF52540
166-414 P-loop containing nucleoside triphosphate hydrolases

RWTTHVVDDSKVYGFDDNVVSMEKLLLEKESHDRFKAVGIVGREGIGKTTLCQLIFNKPEVKNNFLPRIWVCMARHPDDNEDPKLAIVKRMLMQLGVEKKMVSFIFNEKRGLEGLLCALHLQLVGKRYLIVLDDARETDTWYGKLDSCLTSDKKWDDGFAFGLPKGNGGRVIVTSRNEELAKMMVGEENIHRLLPLSDPESCWKIFEDAVENDPILFYPSDLEDLKLEINQKCGGLPLAAKMMGQAMHE

HMMPfam: PF00931
IPR002182
187-413 NB-ARC,NBS
NB-ARC

MEKLLLEKESHDRFKAVGIVGREGIGKTTLCQLIFNKPEVKNNFLPRIWVCMARHPDDNEDPKLAIVKRMLMQLGVEKKMVSFIFNEKRGLEGLLCALHLQLVGKRYLIVLDDARETDTWYGKLDSCLTSDKKWDDGFAFGLPKGNGGRVIVTSRNEELAKMMVGEENIHRLLPLSDPESCWKIFEDAVENDPILFYPSDLEDLKLEINQKCGGLPLAAKMMGQAMH

FPrintScan: PR00364
IPR000767
202-217 DISEASERSIST
Disease resistance protein

AVGIVGREGIGKTTLC

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

QLVGKRYLIVLDDAR

FPrintScan: PR00364
IPR000767
398-412 DISEASERSIST
Disease resistance protein

CGGLPLAAKMMGQAM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox