PRGDB00172465 (ppa003046m)

From PRG Wiki
Jump to: navigation, search
ppa003046m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGTGTTTGCCATTGGCTACAGCCTCTGACAGTCTTCTCTCTCCCAAGGGTGTCAACTATGAAGTGGCTGCATTGATGTCAGTGAAGAGAGAGATGAAGGATGAGCTGCGAGTGATGGAGGGATGGGACATAAACTCCGTTGATCCATGCACTTGGAACATGGTCGGTTGCTCCGTTGAGGGTTTTGTAATCTCCCTTGAAATGGCCAGCACGGGTTTATCGGGAATGCTTTCGCCGAGTATCGGGAACTTGAGTCACCTTCGTACACTGTTGTTACAAAACAATCAGTTATCTGGTCCTATCCCGATGGAGATTGGGAAACTCTCAGAGCTTCAAACTCTTGACCTTTCGGGTAACCAGTTTTCTGGAAACATTCCAAGTTCTTTGGGGTTTCTGACTCACCTAAGTTACTTGAGGCTTAGTAGAAATAAATTGGGCGGTCAAATTCCTAGACTTGTTGCCGATCTCACAGGTCTTTCATTCTTAGATTTGTCGTTTAATAATCTCAGCGGCCCTACTCCAAAAATACAGGCAAAAGGCTACAGCGTTACAGGGAACAGCTTTCTTTGTAATCCTTCATCAGCAGACTCAGCACAAATCTGCTTTGGCGTCTTCAAACCAGTACATGAGACAGGCTTGTCAAAGAAAGCCAGCGGTCACCACCGATGGGTGCTTTCTGTTGCTATAGGCATTAGTTGCACATTTGTCATTTCTGTGATGCTACTTGCTTTTTGGGTGCATTGGTACAGATCTCGTCTTCTCTTTACATCTTATGTGCAGCAAGATTATGAATTTGATATTAGTCATCTGAAGCGGTTCACCTATCGGGAATTGCAAATTGCTACCAGCAATTTTAGTTCCAAAAACATCCTAGGACAAGGTGGATATGGCGTTGTTTATAGAGGATGTCTTCCAAATAGGACAATGGTGGCAGTTAAGAGGCTGAGAGATCCGAATTTCACTGGAGAAGTGCAGTTTCAAACTGAAGTTGAAATGATTGGCTTGGCTTTGCACAGAAACCTTTTACGTTTATATGGCTTTTGTATGACTCCGAATGAGAGGTTGCTTGTTTATCCTTTTATGCCAAATGGGAGTGTTGCTGACCGTTTGAGAGAGACCGGTCGAGAAAAACCATCATTGGATTGGAACAGAAGACTGTGTATAGCCCTTGGGGCTGCCCGAGGACTAGTATACTTGCATGAACAGTGTAATCCAAAAATTATTCACAGGGATGTCAAAGCGGCAAACATTTTACTTGACGAAAGTTATGAAGCTATAGTTGGGGACTTTGGTCTTGCTAAGCTTTTAGATCGGAGGGAATCACATGTCACTACTGCAGTGCGAGGCACTGTGGGACACATAGCACCAGAGTATCTTTCGACCGGACAGTCTTCTGAAAAAACTGATGTTTTTGGATTTGGAATACTGCTTCTGGAACTCATAACCGGGCAAAAGGCATTAGATGCTGGAAATGGTCAAGTTCAGAAGGGAATGATTCTTGATTGGGTTAGAACCCTACATGAGGAGAAGAGGTTGGAGGTGCTAGTAGACAGAGATCTTAAAGGATGTTTCGATGCAATAGAGCTGGAACAATGTGTCGAGTTGGCTCTACAATGTACTCAGTCAAGTCCCATCCTCCGGCCAAAGATGTCAGAGGTCTTGAAGATTTTGGAAGGCTTAGTTGGGCAATCAGGACATACAGAGGCATCACAAGGAGGAAACAACATTTTTGACGCCAGGGCTTGTGATTTCTCCAGGAATTGCAGTGATGTGCATCAAGAATCTTCTTTCATCATTGAAGCTATGGAGCTTTCGGGACCTCGCTGA


Protein sequences

Name Description Sequence
ppa003046m Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

MCLPLATASDSLLSPKGVNYEVAALMSVKREMKDELRVMEGWDINSVDPCTWNMVGCSVEGFVISLEMASTGLSGMLSPSIGNLSHLRTLLLQNNQLSGPIPMEIGKLSELQTLDLSGNQFSGNIPSSLGFLTHLSYLRLSRNKLGGQIPRLVADLTGLSFLDLSFNNLSGPTPKIQAKGYSVTGNSFLCNPSSADSAQICFGVFKPVHETGLSKKASGHHRWVLSVAIGISCTFVISVMLLAFWVHWYRSRLLFTSYVQQDYEFDISHLKRFTYRELQIATSNFSSKNILGQGGYGVVYRGCLPNRTMVAVKRLRDPNFTGEVQFQTEVEMIGLALHRNLLRLYGFCMTPNERLLVYPFMPNGSVADRLRETGREKPSLDWNRRLCIALGAARGLVYLHEQCNPKIIHRDVKAANILLDESYEAIVGDFGLAKLLDRRESHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDAGNGQVQKGMILDWVRTLHEEKRLEVLVDRDLKGCFDAIELEQCVELALQCTQSSPILRPKMSEVLKILEGLVGQSGHTEASQGGNNIFDARACDFSRNCSDVHQESSFIIEAMELSGPR*

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
15-176 L domain-like,LRR

PKGVNYEVAALMSVKREMKDELRVMEGWDINSVDPCTWNMVGCSVEGFVISLEMASTGLSGMLSPSIGNLSHLRTLLLQNNQLSGPIPMEIGKLSELQTLDLSGNQFSGNIPSSLGFLTHLSYLRLSRNKLGGQIPRLVADLTGLSFLDLSFNNLSGPTPKI

HMMPfam: PF08263
IPR013210
19-58 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NYEVAALMSVKREMKDELRVMEGWDINSVDPCTWNMVGCS

HMMPanther: PTHR24420
21-604 FAMILY NOT NAMED,FAMILY NOT NAMED

EVAALMSVKREMKDELRVMEGWDINSVDPCTWNMVGCSVEGFVISLEMASTGLSGMLSPSIGNLSHLRTLLLQNNQLSGPIPMEIGKLSELQTLDLSGNQFSGNIPSSLGFLTHLSYLRLSRNKLGGQIPRLVADLTGLSFLDLSFNNLSGPTPKIQAKGYSVTGNSFLCNPSSADSAQICFGVFKPVHETGLSKKASGHHRWVLSVAIGISCTFVISVMLLAFWVHWYRSRLLFTSYVQQDYEFDISHLKRFTYRELQIATSNFSSKNILGQGGYGVVYRGCLPNRTMVAVKRLRDPNFTGEVQFQTEVEMIGLALHRNLLRLYGFCMTPNERLLVYPFMPNGSVADRLRETGREKPSLDWNRRLCIALGAARGLVYLHEQCNPKIIHRDVKAANILLDESYEAIVGDFGLAKLLDRRESHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDAGNGQVQKGMILDWVRTLHEEKRLEVLVDRDLKGCFDAIELEQCVELALQCTQSSPILRPKMSEVLKILEGLVGQSGHTEASQGGNNIFDARACDFSRNCSDVHQESSFIIEAMEL

HMMPanther: PTHR24420:SF737
21-604 SUBFAMILY NOT NAMED

EVAALMSVKREMKDELRVMEGWDINSVDPCTWNMVGCSVEGFVISLEMASTGLSGMLSPSIGNLSHLRTLLLQNNQLSGPIPMEIGKLSELQTLDLSGNQFSGNIPSSLGFLTHLSYLRLSRNKLGGQIPRLVADLTGLSFLDLSFNNLSGPTPKIQAKGYSVTGNSFLCNPSSADSAQICFGVFKPVHETGLSKKASGHHRWVLSVAIGISCTFVISVMLLAFWVHWYRSRLLFTSYVQQDYEFDISHLKRFTYRELQIATSNFSSKNILGQGGYGVVYRGCLPNRTMVAVKRLRDPNFTGEVQFQTEVEMIGLALHRNLLRLYGFCMTPNERLLVYPFMPNGSVADRLRETGREKPSLDWNRRLCIALGAARGLVYLHEQCNPKIIHRDVKAANILLDESYEAIVGDFGLAKLLDRRESHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDAGNGQVQKGMILDWVRTLHEEKRLEVLVDRDLKGCFDAIELEQCVELALQCTQSSPILRPKMSEVLKILEGLVGQSGHTEASQGGNNIFDARACDFSRNCSDVHQESSFIIEAMEL

Gene3D: G3DSA:3.80.10.10
22-175 no description

VAALMSVKREMKDELRVMEGWDINSVDPCTWNMVGCSVEGFVISLEMASTGLSGMLSPSIGNLSHLRTLLLQNNQLSGPIPMEIGKLSELQTLDLSGNQFSGNIPSSLGFLTHLSYLRLSRNKLGGQIPRLVADLTGLSFLDLSFNNLSGPTPK

HMMPfam: PF13516
84-106 LRR_6,Leucine Rich repeat

LSHLRTLLLQNNQLSGPIPMEIG

HMMPfam: PF13855
110-169 LRR_8,Leucine rich repeat

ELQTLDLSGNQFSGNIPSSLGFLTHLSYLRLSRNKLGGQIPRLVADLTGLSFLDLSFNNL

Seg: seg
159-170 seg

LSFLDLSFNNLS

Gene3D: G3DSA:3.30.200.20
268-361 no description

SHLKRFTYRELQIATSNFSSKNILGQGGYGVVYRGCLPNRTMVAVKRLRDPNFTGEVQFQTEVEMIGLALHRNLLRLYGFCMTPNERLLVYPFM

superfamily: SSF56112
IPR011009
271-555 Protein kinase-like (PK-like)
Protein kinase-like domain

KRFTYRELQIATSNFSSKNILGQGGYGVVYRGCLPNRTMVAVKRLRDPNFTGEVQFQTEVEMIGLALHRNLLRLYGFCMTPNERLLVYPFMPNGSVADRLRETGREKPSLDWNRRLCIALGAARGLVYLHEQCNPKIIHRDVKAANILLDESYEAIVGDFGLAKLLDRRESHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDAGNGQVQKGMILDWVRTLHEEKRLEVLVDRDLKGCFDAIELEQCVELALQCTQSSPILRPKMSEVLK

HMMSmart: SM00219
IPR020635
285-557 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSKNILGQGGYGVVYRGCLPNRTMVAVKRLRDPNFTGEVQFQTEVEMIGLALHRNLLRLYGFCMTPNERLLVYPFMPNGSVADRLRETGREKPSLDWNRRLCIALGAARGLVYLHEQCNPKIIHRDVKAANILLDESYEAIVGDFGLAKLLDRRESHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDAGNGQVQKGMILDWVRTLHEEKRLEVLVDRDLKGCFDAIELEQCVELALQCTQSSPILRPKMSEVLKIL

HMMSmart: SM00220
IPR002290
285-556 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSKNILGQGGYGVVYRGCLPNRTMVAVKRLRDPNFTGEVQFQTEVEMIGLALHRNLLRLYGFCMTPNERLLVYPFMPNGSVADRLRETGREKPSLDWNRRLCIALGAARGLVYLHEQCNPKIIHRDVKAANILLDESYEAIVGDFGLAKLLDRRESHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDAGNGQVQKGMILDWVRTLHEEKRLEVLVDRDLKGCFDAIELEQCVELALQCTQSSPILRPKMSEVLKI

ProfileScan: PS50011
IPR000719
285-561 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSKNILGQGGYGVVYRGCLPNRTMVAVKRLRDPNFTGEVQFQTEVEMIGLALHRNLLRLYGFCMTPNERLLVYPFMPNGSVADRLRETGREKPSLDWNRRLCIALGAARGLVYLHEQCNPKIIHRDVKAANILLDESYEAIVGDFGLAKLLDRRESHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDAGNGQVQKGMILDWVRTLHEEKRLEVLVDRDLKGCFDAIELEQCVELALQCTQSSPILRPKMSEVLKILEGLV

HMMPfam: PF00069
IPR000719
287-555 Pkinase,Ser-thr
Protein kinase, catalytic domain

SKNILGQGGYGVVYRGCLPNRTMVAVKRLRDPNFTGEVQFQTEVEMIGLALHRNLLRLYGFCMTPNERLLVYPFMPNGSVADRLRETGREKPSLDWNRRLCIALGAARGLVYLHEQCNPKIIHRDVKAANILLDESYEAIVGDFGLAKLLDRRESHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDAGNGQVQKGMILDWVRTLHEEKRLEVLVDRDLKGCFDAIELEQCVELALQCTQSSPILRPKMSEVLK

PatternScan: PS00107
IPR017441
291-313 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGYGVVYRGCLPNRTMVAVK

Gene3D: G3DSA:1.10.510.10
363-561 no description

NGSVADRLRETGREKPSLDWNRRLCIALGAARGLVYLHEQCNPKIIHRDVKAANILLDESYEAIVGDFGLAKLLDRRESHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDAGNGQVQKGMILDWVRTLHEEKRLEVLVDRDLKGCFDAIELEQCVELALQCTQSSPILRPKMSEVLKILEGLV

PatternScan: PS00108
IPR008271
407-419 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox