PRGDB00172478 (ppa020993m)

From PRG Wiki
Jump to: navigation, search
ppa020993m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Prunus persica

Comment?

LRR and NB-ARC domains-containing disease resistance protein (best arabidopsis hit)

DNA Sequence

ATGGCAGTAGAATCTGTGCTTACTTTTGCGGCCGAGGGAATACTGACGAAGCTGACTGACCTTGCTGCTCAAGAATTCCGTATGGCCTGGGGATTCAAAGCTGAACTAAGGAAGCTCAGTCAATCCTTACCCATCCTTCAAGATTTCTTAGGAGATGCTGCTGAGAAGGCAAAAGACGGGGGCAAGGCAGTGGAAGATTGGGTGAAGAAACTTAAAGACATAGCTGATGAGGCTGATGATGTCTTGGAAGAAATCAACTATGACTTTCTCCGGAGACGAGTAGAACTGCAAAACCAAATGGGAAAAAAGGTGCTCAACTTACTTTCTGCCTCCAATCCCATTTTGTTTCGACAAAAAATGGCACACAGAATTAGAAAAATCTGCGCTTCTCTGGCGGAGCTCAAGAATGAAGCAGCTTTCATTGGGTTAGTTGCAAAGAAAAAAGATCCAACCTCTCAAAGAATTAGGGAGGACAGAGAAACCAACGCATTCATTGGTAAAGATGAAATCATCATTGGAAGGAATGCGGTTGTGTCAGATATAGTTACAACATTGACCGACTCCAATACTAATGAACAAAATCTGTCGGTTATGGCAATTGCGGGAATGCCAGGACTGGGAAAGACAACTTTGGCCAAGTCAGTGTACAATGAAGGTGCTATCGATGAGTATTTCAACAAAAAATTGTGGGTGTGTGTATCAAACACTTTCAACGTCAATTCAATTTTAGCTGCGATGTTAGAATTACTCTCAGGAAAGGTAGCGACGACAAGTCAGCAAGCATTGCTTACAGACCTCCAAGAAAAGTTGAAAGAGAAAAAATACTTGCTGGTACTTGATGATGTTTGGAATGAAGATTCGGAGAAATGGGAACGTTTGATGAGCTGTTTGTCAAAGTTGAATTCTGCTCCAGGAAGCAAAATTATTGTCACTACCCGCAGTGGCAAAGTAGCATCAATCACAGAAACACTTCCGCGGCCTAAATTGGAACTTCTATCAACAGATGAATGCTGGTCCATATTGAAACATGCAGCTTGCTCAGATGGTAGTTCTGATATACCTCTTGGTGTAGAGAGAATTGGTTGGGAAATTGCTAAAAATTGTGAAGGTCTACCATTGATGGCAAAG


Protein sequences

Name Description Sequence
ppa020993m LRR and NB-ARC domains-containing disease resistance protein (best arabidopsis hit)

MAVESVLTFAAEGILTKLTDLAAQEFRMAWGFKAELRKLSQSLPILQDFLGDAAEKAKDGGKAVEDWVKKLKDIADEADDVLEEINYDFLRRRVELQNQMGKKVLNLLSASNPILFRQKMAHRIRKICASLAELKNEAAFIGLVAKKKDPTSQRIREDRETNAFIGKDEIIIGRNAVVSDIVTTLTDSNTNEQNLSVMAIAGMPGLGKTTLAKSVYNEGAIDEYFNKKLWVCVSNTFNVNSILAAMLELLSGKVATTSQQALLTDLQEKLKEKKYLLVLDDVWNEDSEKWERLMSCLSKLNSAPGSKIIVTTRSGKVASITETLPRPKLELLSTDECWSILKHAACSDGSSDIPLGVERIGWEIAKNCEGLPLMAK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
7-309 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LTFAAEGILTKLTDLAAQEFRMAWGFKAELRKLSQSLPILQDFLGDAAEKAKDGGKAVEDWVKKLKDIADEADDVLEEINYDFLRRRVELQNQMGKKVLNLLSASNPILFRQKMAHRIRKICASLAELKNEAAFIGLVAKKKDPTSQRIREDRETNAFIGKDEIIIGRNAVVSDIVTTLTDSNTNEQNLSVMAIAGMPGLGKTTLAKSVYNEGAIDEYFNKKLWVCVSNTFNVNSILAAMLELLSGKVATTSQQALLTDLQEKLKEKKYLLVLDDVWNEDSEKWERLMSCLSKLNSAPGSKII

HMMPanther: PTHR23155
7-309 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LTFAAEGILTKLTDLAAQEFRMAWGFKAELRKLSQSLPILQDFLGDAAEKAKDGGKAVEDWVKKLKDIADEADDVLEEINYDFLRRRVELQNQMGKKVLNLLSASNPILFRQKMAHRIRKICASLAELKNEAAFIGLVAKKKDPTSQRIREDRETNAFIGKDEIIIGRNAVVSDIVTTLTDSNTNEQNLSVMAIAGMPGLGKTTLAKSVYNEGAIDEYFNKKLWVCVSNTFNVNSILAAMLELLSGKVATTSQQALLTDLQEKLKEKKYLLVLDDVWNEDSEKWERLMSCLSKLNSAPGSKII

Seg: seg
51-63 seg

GDAAEKAKDGGKA

Coil: coil
64-85 coiled-coil

VEDWVKKLKDIADEADDVLEEI

superfamily: SSF52540
154-373 P-loop containing nucleoside triphosphate hydrolases

RIREDRETNAFIGKDEIIIGRNAVVSDIVTTLTDSNTNEQNLSVMAIAGMPGLGKTTLAKSVYNEGAIDEYFNKKLWVCVSNTFNVNSILAAMLELLSGKVATTSQQALLTDLQEKLKEKKYLLVLDDVWNEDSEKWERLMSCLSKLNSAPGSKIIVTTRSGKVASITETLPRPKLELLSTDECWSILKHAACSDGSSDIPLGVERIGWEIAKNCEGLPL

Gene3D: G3DSA:3.40.50.300
172-314 no description

IGRNAVVSDIVTTLTDSNTNEQNLSVMAIAGMPGLGKTTLAKSVYNEGAIDEYFNKKLWVCVSNTFNVNSILAAMLELLSGKVATTSQQALLTDLQEKLKEKKYLLVLDDVWNEDSEKWERLMSCLSKLNSAPGSKIIVTTRS

HMMPfam: PF00931
IPR002182
178-374 NB-ARC,NBS
NB-ARC

VSDIVTTLTDSNTNEQNLSVMAIAGMPGLGKTTLAKSVYNEGAIDEYFNKKLWVCVSNTFNVNSILAAMLELLSGKVATTSQQALLTDLQEKLKEKKYLLVLDDVWNEDSEKWERLMSCLSKLNSAPGSKIIVTTRSGKVASITETLPRPKLELLSTDECWSILKHAACSDGSSDIPLGVERIGWEIAKNCEGLPLM

FPrintScan: PR00364
IPR000767
197-212 DISEASERSIST
Disease resistance protein

VMAIAGMPGLGKTTLA

Seg: seg
268-282 seg

EKLKEKKYLLVLDDV

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

KLKEKKYLLVLDDVW

FPrintScan: PR00364
IPR000767
368-376 DISEASERSIST
Disease resistance protein

CEGLPLMAK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox