PRGDB00172481 (ppa014824m)

From PRG Wiki
Jump to: navigation, search
ppa014824m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

wall associated kinase-like 1 (best arabidopsis hit)

DNA Sequence

ATGAATTTCATATCCATTATTCTGTTGTTATGGCGCATAATAATACTAAGTTGTGGCTATGGAGCTGCAACAACTAGTGCAGCATCACTGCCTATAGCAAAGCCTAATTGCACAACGCATTGTGGAGATGTTGCCATCCCATACCCTTTCGGGATTGGACCTAGCAAAGATTGTTACTTGGATAAATGGTTTCAAATAGACTGCAGGCACACCAACTCTACAACCTCAGCTAATTACAGCAGGCAAGTGCCTTTCCTCAAGAGCGTCAACCTGGAGCTGCTAAGTATTTCTCCCTTTGAAGATGGCAGTGGCACGCAATCGGTTCAGGTTAAGAACCCTATTACTTTCTTCAGCTGCAAGGGAAAGGAAACTCGCCAACCCCAGAATTTGACGGGCAGCCCTTTCATTTACTCTCAGACATACAACACATTCATTGCAGTGAGTTGTGACCTCTTTGCCCTTATGAGATCAGATCATGGGACTCTCGCTGGTTGCTGGTCGATTTGTCGAAACAATACGGGCGGCGACTTTAGCACCTGCTATAAAGGTATTGACTGTTGCGAAGGTTTCCTTCCAAGCTATGAACTCACCAATTTTAGTATTGAGATACCATCAAATTCATCAACATCAGATCCAATGGGCGATTGCAAGTATGCATTTTTGGTTGACTCTAGTTTTATGAATAACTTAACGAATTTTGAAGACGTGAAGGATATGGACAGCGTTCCTGTGGTGCTAGACTGGATGTTAAATGTAGATGACTATGGTGAAAGATTCAGTGAAGGATTCAGAGAAAAACCAGACCTGACTGGTAACCAATCAACACCCTTTTGCACCAATGATTCGACTTCTCAGTACAACCGGAACACGATGACTTGTATCTGTCCGCCAGGCATGGAAGGAAATCCTTATCTTCTCCAACTTTGTCAAGGCCTTGGCTCCGGTGTTGGGCTATTGTTACTACTCATTGGTGCATGGTGGGTAAACAAAATCGTGAAGAAAAGGAAAACCATCGCACGCAAGAAAATGCTTTTCAAACGAAATGGTGGTTTATTGTTAGAGCAACAGTTATCGTCTGGCGAAGTTAATGTTGACAAAATCAAGTTATTCAATTCAAAGGAATTAGAAAAGGCCACCAACAATTTTAGTATTGATAGAATTCTTGGTCATGGAGGTCAAGGTACCGTTTACAAAGGCATGTTGGTGGATGGAAGAATTGTTGCGGTAAAGAAGTCCAAAATGGTGGACACAAGCATGCTCTCGGAATTCATCAATGAGGTTGTAATTCTATCACAAATCAACCACAGAAATGTGGTTCAAATTATGGGTTGTTGTTTAGAGACCGAAGTTCCACTTTTGGTCTACGAATTCATACCGAATGGAACTCTTTCTCAATATATCCAAGGGCAGATTGAGGAATTCTCACTCACTTGGGAAATGCGGTTGCAAATTGCCACCGAAGTTGCAGGAGCTCTTTCGTACTTACACGGTGCAGCTTCCGTTCCCATATATCATAGAGACATCAAGTCTGCCAACATACTTTTGGATGGACGATACAGAGCAAAAATTGCAGATTTTGGAACTTCAAGATCAATTTCCATTGACCAAACTCATCTAACCACATGTGTACATGGAACATTTGGTTACTTGGACCCAGAGTACTTTCAATCAAGCCAATTTACGGAGAAAAGTGACGTCTATAGCTTTGGAGTGGTCCTTGTTGAACTCTTGACAGGGCAAAAACCAATTTCTGCAGTAACATGGTCACAAGAAGAAGAATACAGAAGTCTTGCCACATATTTCCTTACCTCGATGCAAGACGATCGTCTGTTTAATGTTGTTGATGCTCGAGTTCTGAAGGAGGGCTCTGAAACAGAAATCCAGGTAGTCGCTAACCTTGCAAGGAGATGCTTGAATTTGAATGGAAGAAACCGTCCTACAATGAGAGAGGTTACATCAGAGCTAGAGGCTGTACAAATGTCAAGAAAACCTTCCATTAGTGCTCAGCAAAATTCTGAAGGGGTTGATTTTGTGGAAGACGTTTCAGTTTGGCATTGGGATGTTGAATCACTTTCAGAAGTGTCGGCTAGGGATATTACTACACCAAACTGCCTGGGAGAGAAGATTAGTCTGGAACCAAGGCAGAAAATCCATTTGAAAGAAATGGCCCTGATGACGAGGCATTAA


Protein sequences

Name Description Sequence
ppa014824m wall associated kinase-like 1 (best arabidopsis hit)

MNFISIILLLWRIIILSCGYGAATTSAASLPIAKPNCTTHCGDVAIPYPFGIGPSKDCYLDKWFQIDCRHTNSTTSANYSRQVPFLKSVNLELLSISPFEDGSGTQSVQVKNPITFFSCKGKETRQPQNLTGSPFIYSQTYNTFIAVSCDLFALMRSDHGTLAGCWSICRNNTGGDFSTCYKGIDCCEGFLPSYELTNFSIEIPSNSSTSDPMGDCKYAFLVDSSFMNNLTNFEDVKDMDSVPVVLDWMLNVDDYGERFSEGFREKPDLTGNQSTPFCTNDSTSQYNRNTMTCICPPGMEGNPYLLQLCQGLGSGVGLLLLLIGAWWVNKIVKKRKTIARKKMLFKRNGGLLLEQQLSSGEVNVDKIKLFNSKELEKATNNFSIDRILGHGGQGTVYKGMLVDGRIVAVKKSKMVDTSMLSEFINEVVILSQINHRNVVQIMGCCLETEVPLLVYEFIPNGTLSQYIQGQIEEFSLTWEMRLQIATEVAGALSYLHGAASVPIYHRDIKSANILLDGRYRAKIADFGTSRSISIDQTHLTTCVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISAVTWSQEEEYRSLATYFLTSMQDDRLFNVVDARVLKEGSETEIQVVANLARRCLNLNGRNRPTMREVTSELEAVQMSRKPSISAQQNSEGVDFVEDVSVWHWDVESLSEVSARDITTPNCLGEKISLEPRQKIHLKEMALMTRH*

Domains

Domain Start-End Description Sequence

Seg: seg
4-16 seg

ISIILLLWRIIIL

HMMPfam: PF13947
IPR025287
34-150 GUB_WAK_bind
Wall-associated receptor kinase galacturonan-bindi

KPNCTTHCGDVAIPYPFGIGPSKDCYLDKWFQIDCRHTNSTTSANYSRQVPFLKSVNLELLSISPFEDGSGTQSVQVKNPITFFSCKGKETRQPQNLTGSPFIYSQTYNTFIAVSCD

HMMPfam: PF08488
IPR013695
182-255 WAK
Wall-associated kinase

KGIDCCEGFLPSYELTNFSIEIPSNSSTSDPMGDCKYAFLVDSSFMNNLTNFEDVKDMDSVPVVLDWMLNVDDY

HMMPanther: PTHR24420
205-728 FAMILY NOT NAMED,FAMILY NOT NAMED

SNSSTSDPMGDCKYAFLVDSSFMNNLTNFEDVKDMDSVPVVLDWMLNVDDYGERFSEGFREKPDLTGNQSTPFCTNDSTSQYNRNTMTCICPPGMEGNPYLLQLCQGLGSGVGLLLLLIGAWWVNKIVKKRKTIARKKMLFKRNGGLLLEQQLSSGEVNVDKIKLFNSKELEKATNNFSIDRILGHGGQGTVYKGMLVDGRIVAVKKSKMVDTSMLSEFINEVVILSQINHRNVVQIMGCCLETEVPLLVYEFIPNGTLSQYIQGQIEEFSLTWEMRLQIATEVAGALSYLHGAASVPIYHRDIKSANILLDGRYRAKIADFGTSRSISIDQTHLTTCVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISAVTWSQEEEYRSLATYFLTSMQDDRLFNVVDARVLKEGSETEIQVVANLARRCLNLNGRNRPTMREVTSELEAVQMSRKPSISAQQNSEGVDFVEDVSVWHWDVESLSEVSARDITTPNCLGEKISLEPRQKIHLKEMALMTRH

HMMPanther: PTHR24420:SF444
205-728 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SNSSTSDPMGDCKYAFLVDSSFMNNLTNFEDVKDMDSVPVVLDWMLNVDDYGERFSEGFREKPDLTGNQSTPFCTNDSTSQYNRNTMTCICPPGMEGNPYLLQLCQGLGSGVGLLLLLIGAWWVNKIVKKRKTIARKKMLFKRNGGLLLEQQLSSGEVNVDKIKLFNSKELEKATNNFSIDRILGHGGQGTVYKGMLVDGRIVAVKKSKMVDTSMLSEFINEVVILSQINHRNVVQIMGCCLETEVPLLVYEFIPNGTLSQYIQGQIEEFSLTWEMRLQIATEVAGALSYLHGAASVPIYHRDIKSANILLDGRYRAKIADFGTSRSISIDQTHLTTCVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISAVTWSQEEEYRSLATYFLTSMQDDRLFNVVDARVLKEGSETEIQVVANLARRCLNLNGRNRPTMREVTSELEAVQMSRKPSISAQQNSEGVDFVEDVSVWHWDVESLSEVSARDITTPNCLGEKISLEPRQKIHLKEMALMTRH

Seg: seg
305-324 seg

LLQLCQGLGSGVGLLLLLIG

Seg: seg
349-361 seg

GGLLLEQQLSSGE

superfamily: SSF56112
IPR011009
354-678 Protein kinase-like (PK-like)
Protein kinase-like domain

EQQLSSGEVNVDKIKLFNSKELEKATNNFSIDRILGHGGQGTVYKGMLVDGRIVAVKKSKMVDTSMLSEFINEVVILSQINHRNVVQIMGCCLETEVPLLVYEFIPNGTLSQYIQGQIEEFSLTWEMRLQIATEVAGALSYLHGAASVPIYHRDIKSANILLDGRYRAKIADFGTSRSISIDQTHLTTCVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISAVTWSQEEEYRSLATYFLTSMQDDRLFNVVDARVLKEGSETEIQVVANLARRCLNLNGRNRPTMREVTSELEAVQMSRKPSISAQQNSEGVDFV

Gene3D: G3DSA:3.30.200.20
365-443 no description

DKIKLFNSKELEKATNNFSIDRILGHGGQGTVYKGMLVDGRIVAVKKSKMVDTSMLSEFINEVVILSQINHRNVVQIMG

HMMSmart: SM00219
IPR020635
382-655 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSIDRILGHGGQGTVYKGMLVDGRIVAVKKSKMVDTSMLSEFINEVVILSQINHRNVVQIMGCCLETEVPLLVYEFIPNGTLSQYIQGQIEEFSLTWEMRLQIATEVAGALSYLHGAASVPIYHRDIKSANILLDGRYRAKIADFGTSRSISIDQTHLTTCVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISAVTWSQEEEYRSLATYFLTSMQDDRLFNVVDARVLKEGSETEIQVVANLARRCLNLNGRNRPTMREVTSEL

HMMSmart: SM00220
IPR002290
382-658 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSIDRILGHGGQGTVYKGMLVDGRIVAVKKSKMVDTSMLSEFINEVVILSQINHRNVVQIMGCCLETEVPLLVYEFIPNGTLSQYIQGQIEEFSLTWEMRLQIATEVAGALSYLHGAASVPIYHRDIKSANILLDGRYRAKIADFGTSRSISIDQTHLTTCVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISAVTWSQEEEYRSLATYFLTSMQDDRLFNVVDARVLKEGSETEIQVVANLARRCLNLNGRNRPTMREVTSELEAV

ProfileScan: PS50011
IPR000719
382-658 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSIDRILGHGGQGTVYKGMLVDGRIVAVKKSKMVDTSMLSEFINEVVILSQINHRNVVQIMGCCLETEVPLLVYEFIPNGTLSQYIQGQIEEFSLTWEMRLQIATEVAGALSYLHGAASVPIYHRDIKSANILLDGRYRAKIADFGTSRSISIDQTHLTTCVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISAVTWSQEEEYRSLATYFLTSMQDDRLFNVVDARVLKEGSETEIQVVANLARRCLNLNGRNRPTMREVTSELEAV

HMMPfam: PF00069
IPR000719
383-652 Pkinase,Ser-thr
Protein kinase, catalytic domain

SIDRILGHGGQGTVYKGMLVDGRIVAVKKSKMVDTSMLSEFINEVVILSQINHRNVVQIMGCCLETEVPLLVYEFIPNGTLSQYIQGQIEEFSLTWEMRLQIATEVAGALSYLHGAASVPIYHRDIKSANILLDGRYRAKIADFGTSRSISIDQTHLTTCVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISAVTWSQEEEYRSLATYFLTSMQDDRLFNVVDARVLKEGSETEIQVVANLARRCLNLNGRNRPTMREVT

Gene3D: G3DSA:1.10.510.10
444-662 no description

CCLETEVPLLVYEFIPNGTLSQYIQGQIEEFSLTWEMRLQIATEVAGALSYLHGAASVPIYHRDIKSANILLDGRYRAKIADFGTSRSISIDQTHLTTCVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISAVTWSQEEEYRSLATYFLTSMQDDRLFNVVDARVLKEGSETEIQVVANLARRCLNLNGRNRPTMREVTSELEAVQMSR

PatternScan: PS00108
IPR008271
503-515 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IYHRDIKSANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox