PRGDB00172485 (ppa025258m)

From PRG Wiki
Jump to: navigation, search
ppa025258m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Prunus persica

Comment?

disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

TTTATGCCTTTCTTAGTCATCTCAGCAAATGTCATCAAATGTGTTTGCTTTGATTCCATATCTCGGTCGTTATTATGCTTTGATTTACCAGGTGTTTGCTATGTAGGTATTTGGGGCATGGGTGGGATTGGCAAGACTGCCCTTGCTGATGTTGTATTTCACAGGCTTTCCTCTGAATTTGAAGCTTCTTGTTTTCTTGCAAATGTTAGGGAGGAATTAGAAAAACATGGACTAAATCACTTGCGAAATAAACTTTTTCGTGAGATATTAAAGGACAAAGATCTAAATATCGACACTCCGTCTATTGGATCAACTTTTACTCGAGAAAGGATCAGCCGTAAAAAGGCCCTCATTGTTCTTGATGATGCGAATGGTTCAAGCCAACTAGAATTTCTTGTTGGTGACCATGATCAATTTTGCCGCGGAAGTCTAATAATTATAACAACTAGAGATAGGAGCCTACTTGAGGAAAAGGTTGATGATGATAAGATATACGAGGTTGAGAGATTAAGTCCCAATGAAGCTCTATTGCTCTTTCAGTCGCTTGCTTTCGAAAATAAGTCTCCAAAAGTAGAGTTTTCTGAGTTGTCAAGAAAGGTGGTATATGATGTTAAAGGCATTCCATTAGCTCTTAAAACTTTGGGTCCCTTATTCCTTCCACACAAGAGAATAGAAGACTGGGAAGAAGAATTGAGCAAATTGAAAAAATTCCCTTACGAAGAAATTCTGAGTGTGTTGAGACATAGTTACAATGGATTAGAAAAGAATGAGAGGGAGATATTTCTCGATATAGCATGTTTTTATAAAGGGATGGATATGGATTTTGTGATAAAAATGATACATCTTCACGGTTTCTATGCGGTGGGGATTAAAGTTCTCATTGCTAAGTCCCTCATATCGATTTCAACAAGTAACTGCCTAGAGATGCATGATATGCTACAAGAAATGAGTTGGGCAATTGTTTCTTTCAACTTTTCAACTACTCACCACGTTTCAACTAACTCATTCACTCCACCATTCAACCAATCTCGGATCCATATGGGTGGCATGTTAACAATTACATGCAAAATTATTTTGGGGATTTATCATTCGATGACTACTCTTCACAATACACTTACTCTACACATAGAGATGATGAAGATAGTGAAAGTTTTGAACCTCATAGGAACTCTATGTGTTCCTGATCTGTCTGGGAGTTCAAACCTTGAGCATATAGATCTTTGTGAATGTACAAGTTTGGTTCAGGTTCCTTCTTATTTTCAAACTTTTGACAAACTTACTTATCTTGATCTGGGAGGCTGCCTGAATCTCAACTATCTTCCTGAGATGCCTGTCAACATTGAATCCTTAGATTTATCTGAGACTGCAATAAAGGAATTGCCTTCATCAGTTTGGTCTCTAGAAAAACTTTGTTCCTTGAATGTTAATCATTGTAAAGCCCTTGAGAAACTTCCGAGCAACAGTTGTAATCTGAAAGTCTCCGGTACTTTTAGTCTAAACGGCTGCGTATCTCTTGGCGAGTTTTCGGAGCTTCCCAGGTATATAAGCTACCTAGATTTGAGTAAGACAGCAATAAAAGAATTGCCGTCATCATTGGAGTCTCTCTTCGGTCTCACTTCAATTCGTCTATTCGCTTGTGGCAGCCTTCTGAGTCTCTCAACAAGCATTCACAAGTTAAAATCTCTTGAGATTCTTGATCTTCAATTATGCTCTAAATTCCAGTACTTCCCAGAAATACTGGAGCCTATGGAACATTTGACGTCTCTTAGTTTATCAAGTACAGCGGTTAAAGTTCTACCCTCATCGATAGGAAATCTAATTGGGCTTCGAAAATTAGATCTCCATCACTGCGGGGACCTTGAGGTTGTCCCAAACAGTATCTACAGTCTAAGTAAACTTGAAACTCTCAACTTTCATGGCTCCTGGTGCCTTGGGAAATTGCCTCCCGCCTCAGTAGACCAAGTCAGATTGCTCTCTTTGAAAGAACTAATCCTCGCTGAGTGCGGTATCAAAGAAATCCCTGATGCCCTCGTTTGCTTAACCTCATTATGTTCCTTAGATTTGAAAGATACCGGAGTTAAGAGCATACCTGCAAGCATCAAACAAGCTGCTCAGCCGTCTTCCCTGTGCCTAACCTATTGCCAGAGCCTTGAGTCTTTGCCAGAGCTCCCCCCATTGCTGCAATGTCTTGAAGCAGGTCGTTGCACGTCACTGAAGAAAGTGTCAAGTTCAAGGACTGCACTCACACAAGGTTGGGACGTATTTTCTCCTCCACGGCTTGAGGAGAAACCTATATTTTCTGGATGCCCAAAGTTGGATGAGAATGCAAGAAGTGTTGGGTTTTTAGAGAACAAAATAGTGATTTTATTTATTCAACAAAAGATAGATTTCTTGGGCTTTGCTCCTTCTGTTGTTGTATACATCAACAATAATGCTGGCTGGTTGGACTGTGGATACAAGTACATCTTCGACATTGGATGCAAGTACAACTTCAAAACTAGCAATGGTGAAAGCCACGAAATCAACCATCCTTTTTATAGACCGTATCCGTATGTAAGGACTTCAGTTGATTCCCATGAGTTGTTTGTGTGGTGGTATAATAATGTCTTTCAAGTTGTAGGGGGAGCTGAAATCCCCACGGCCTTCTACAAACTAGTCACTGAGGCCTCTGTTGACTTCTCACTGAAACAAGACCGCCGCAAACCCTTTCCGGAGTTGGAGGTGGTAAAGTGTGGAATCTGCCTGTTGTATGCCCAAGATGCTGAGATCATCAAGCAAAGGAATTTGTAG


Protein sequences

Name Description Sequence
ppa025258m disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

FMPFLVISANVIKCVCFDSISRSLLCFDLPGVCYVGIWGMGGIGKTALADVVFHRLSSEFEASCFLANVREELEKHGLNHLRNKLFREILKDKDLNIDTPSIGSTFTRERISRKKALIVLDDANGSSQLEFLVGDHDQFCRGSLIIITTRDRSLLEEKVDDDKIYEVERLSPNEALLLFQSLAFENKSPKVEFSELSRKVVYDVKGIPLALKTLGPLFLPHKRIEDWEEELSKLKKFPYEEILSVLRHSYNGLEKNEREIFLDIACFYKGMDMDFVIKMIHLHGFYAVGIKVLIAKSLISISTSNCLEMHDMLQEMSWAIVSFNFSTTHHVSTNSFTPPFNQSRIHMGGMLTITCKIILGIYHSMTTLHNTLTLHIEMMKIVKVLNLIGTLCVPDLSGSSNLEHIDLCECTSLVQVPSYFQTFDKLTYLDLGGCLNLNYLPEMPVNIESLDLSETAIKELPSSVWSLEKLCSLNVNHCKALEKLPSNSCNLKVSGTFSLNGCVSLGEFSELPRYISYLDLSKTAIKELPSSLESLFGLTSIRLFACGSLLSLSTSIHKLKSLEILDLQLCSKFQYFPEILEPMEHLTSLSLSSTAVKVLPSSIGNLIGLRKLDLHHCGDLEVVPNSIYSLSKLETLNFHGSWCLGKLPPASVDQVRLLSLKELILAECGIKEIPDALVCLTSLCSLDLKDTGVKSIPASIKQAAQPSSLCLTYCQSLESLPELPPLLQCLEAGRCTSLKKVSSSRTALTQGWDVFSPPRLEEKPIFSGCPKLDENARSVGFLENKIVILFIQQKIDFLGFAPSVVVYINNNAGWLDCGYKYIFDIGCKYNFKTSNGESHEINHPFYRPYPYVRTSVDSHELFVWWYNNVFQVVGGAEIPTAFYKLVTEASVDFSLKQDRRKPFPELEVVKCGICLLYAQDAEIIKQRNL*

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
30-242 P-loop containing nucleoside triphosphate hydrolases

PGVCYVGIWGMGGIGKTALADVVFHRLSSEFEASCFLANVREELEKHGLNHLRNKLFREILKDKDLNIDTPSIGSTFTRERISRKKALIVLDDANGSSQLEFLVGDHDQFCRGSLIIITTRDRSLLEEKVDDDKIYEVERLSPNEALLLFQSLAFENKSPKVEFSELSRKVVYDVKGIPLALKTLGPLFLPHKRIEDWEEELSKLKKFPYEEI

HMMPfam: PF00931
IPR002182
30-283 NB-ARC,NBS
NB-ARC

PGVCYVGIWGMGGIGKTALADVVFHRLSSEFEASCFLANVREELEKHGLNHLRNKLFREILKDKDLNIDTPSIGSTFTRERISRKKALIVLDDANGSSQLEFLVGDHDQFCRGSLIIITTRDRSLLEEKVDDDKIYEVERLSPNEALLLFQSLAFENKSPKVEFSELSRKVVYDVKGIPLALKTLGPLFLPHKRIEDWEEELSKLKKFPYEEILSVLRHSYNGLEKNEREIFLDIACFYKGMDMDFVIKMIHLH

HMMPanther: PTHR11017
31-777 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GVCYVGIWGMGGIGKTALADVVFHRLSSEFEASCFLANVREELEKHGLNHLRNKLFREILKDKDLNIDTPSIGSTFTRERISRKKALIVLDDANGSSQLEFLVGDHDQFCRGSLIIITTRDRSLLEEKVDDDKIYEVERLSPNEALLLFQSLAFENKSPKVEFSELSRKVVYDVKGIPLALKTLGPLFLPHKRIEDWEEELSKLKKFPYEEILSVLRHSYNGLEKNEREIFLDIACFYKGMDMDFVIKMIHLHGFYAVGIKVLIAKSLISISTSNCLEMHDMLQEMSWAIVSFNFSTTHHVSTNSFTPPFNQSRIHMGGMLTITCKIILGIYHSMTTLHNTLTLHIEMMKIVKVLNLIGTLCVPDLSGSSNLEHIDLCECTSLVQVPSYFQTFDKLTYLDLGGCLNLNYLPEMPVNIESLDLSETAIKELPSSVWSLEKLCSLNVNHCKALEKLPSNSCNLKVSGTFSLNGCVSLGEFSELPRYISYLDLSKTAIKELPSSLESLFGLTSIRLFACGSLLSLSTSIHKLKSLEILDLQLCSKFQYFPEILEPMEHLTSLSLSSTAVKVLPSSIGNLIGLRKLDLHHCGDLEVVPNSIYSLSKLETLNFHGSWCLGKLPPASVDQVRLLSLKELILAECGIKEIPDALVCLTSLCSLDLKDTGVKSIPASIKQAAQPSSLCLTYCQSLESLPELPPLLQCLEAGRCTSLKKVSSSRTALTQGWDVFSPPRLEEKPIFSGCPKLDENAR

HMMPanther: PTHR11017:SF20
31-777 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GVCYVGIWGMGGIGKTALADVVFHRLSSEFEASCFLANVREELEKHGLNHLRNKLFREILKDKDLNIDTPSIGSTFTRERISRKKALIVLDDANGSSQLEFLVGDHDQFCRGSLIIITTRDRSLLEEKVDDDKIYEVERLSPNEALLLFQSLAFENKSPKVEFSELSRKVVYDVKGIPLALKTLGPLFLPHKRIEDWEEELSKLKKFPYEEILSVLRHSYNGLEKNEREIFLDIACFYKGMDMDFVIKMIHLHGFYAVGIKVLIAKSLISISTSNCLEMHDMLQEMSWAIVSFNFSTTHHVSTNSFTPPFNQSRIHMGGMLTITCKIILGIYHSMTTLHNTLTLHIEMMKIVKVLNLIGTLCVPDLSGSSNLEHIDLCECTSLVQVPSYFQTFDKLTYLDLGGCLNLNYLPEMPVNIESLDLSETAIKELPSSVWSLEKLCSLNVNHCKALEKLPSNSCNLKVSGTFSLNGCVSLGEFSELPRYISYLDLSKTAIKELPSSLESLFGLTSIRLFACGSLLSLSTSIHKLKSLEILDLQLCSKFQYFPEILEPMEHLTSLSLSSTAVKVLPSSIGNLIGLRKLDLHHCGDLEVVPNSIYSLSKLETLNFHGSWCLGKLPPASVDQVRLLSLKELILAECGIKEIPDALVCLTSLCSLDLKDTGVKSIPASIKQAAQPSSLCLTYCQSLESLPELPPLLQCLEAGRCTSLKKVSSSRTALTQGWDVFSPPRLEEKPIFSGCPKLDENAR

FPrintScan: PR00364
IPR000767
34-49 DISEASERSIST
Disease resistance protein

YVGIWGMGGIGKTALA

Gene3D: G3DSA:3.40.50.300
35-160 no description

VGIWGMGGIGKTALADVVFHRLSSEFEASCFLANVREELEKHGLNHLRNKLFREILKDKDLNIDTPSIGSTFTRERISRKKALIVLDDANGSSQLEFLVGDHDQFCRGSLIIITTRDRSLLEEKVD

FPrintScan: PR00364
IPR000767
110-124 DISEASERSIST
Disease resistance protein

RISRKKALIVLDDAN

FPrintScan: PR00364
IPR000767
204-218 DISEASERSIST
Disease resistance protein

VKGIPLALKTLGPLF

superfamily: SSF52058
308-794 L domain-like,LRR

EMHDMLQEMSWAIVSFNFSTTHHVSTNSFTPPFNQSRIHMGGMLTITCKIILGIYHSMTTLHNTLTLHIEMMKIVKVLNLIGTLCVPDLSGSSNLEHIDLCECTSLVQVPSYFQTFDKLTYLDLGGCLNLNYLPEMPVNIESLDLSETAIKELPSSVWSLEKLCSLNVNHCKALEKLPSNSCNLKVSGTFSLNGCVSLGEFSELPRYISYLDLSKTAIKELPSSLESLFGLTSIRLFACGSLLSLSTSIHKLKSLEILDLQLCSKFQYFPEILEPMEHLTSLSLSSTAVKVLPSSIGNLIGLRKLDLHHCGDLEVVPNSIYSLSKLETLNFHGSWCLGKLPPASVDQVRLLSLKELILAECGIKEIPDALVCLTSLCSLDLKDTGVKSIPASIKQAAQPSSLCLTYCQSLESLPELPPLLQCLEAGRCTSLKKVSSSRTALTQGWDVFSPPRLEEKPIFSGCPKLDENARSVGFLENKIVILFIQQK

Gene3D: G3DSA:3.80.10.10
393-492 no description

VPDLSGSSNLEHIDLCECTSLVQVPSYFQTFDKLTYLDLGGCLNLNYLPEMPVNIESLDLSETAIKELPSSVWSLEKLCSLNVNHCKALEKLPSNSCNLK

HMMPfam: PF00560
IPR001611
425-442 LRR_1
Leucine-rich repeat

KLTYLDLGGCLNLNYLPE

Gene3D: G3DSA:3.80.10.10
515-724 no description

ISYLDLSKTAIKELPSSLESLFGLTSIRLFACGSLLSLSTSIHKLKSLEILDLQLCSKFQYFPEILEPMEHLTSLSLSSTAVKVLPSSIGNLIGLRKLDLHHCGDLEVVPNSIYSLSKLETLNFHGSWCLGKLPPASVDQVRLLSLKELILAECGIKEIPDALVCLTSLCSLDLKDTGVKSIPASIKQAAQPSSLCLTYCQSLESLPELP

FPrintScan: PR00364
IPR000767
557-573 DISEASERSIST
Disease resistance protein

HKLKSLEILDLQLCSKF

Seg: seg
714-731 seg

CQSLESLPELPPLLQCLE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox