PRGDB00172488 (ppa001467m)

From PRG Wiki
Jump to: navigation, search
ppa001467m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGGCTGGTGGGACTATTAGATTGCTTATAGGGGTTTCTTCAATTTTGTATCTGATATGTGGTTCATTGGGATTTAATCCAGTGGATAAGCATCTGATAATCTGTGGATCAAAAACCAATGTAAAAGTTGGTGATCGTGTATTTGTATCTGATGAGTCTGATTCCAGTATCCTCTCAACCCCACAAAAAATCTCTGGCAATTCAAGTTCCATATCTTCCTCCTTAGATTCAGTTCTGTACCGAAGTGCAAGAATATTTAGTGGAACCTCCGTTTACACATTTCCAATAAGAAAACAAGGGCGTCATTGGGTTCGCCTCTATTTCTCTCCTTTTGTTCATGAGGGTTACAATTTGAGCACAGCAAAGTTCTCTGTTTCTGCTCAAACTTTCACCCTTCTCAAGGAGTTTAAAATAGAGAGCGGTTACCGCATGAGAGAATACTCTTTGAACATAACTTCGGACAGTCTAGTTCTCACCTTTACTCCTGCCACCAATTCATTTGCTTTTATAAATGCCTTAGAAGTTGTTTCGCTCCCGGACGAGCTCATTCCAGAGGATGCCATAACCATTGGTTCAAAGGAAAATCACCAAAATTTGAGGAAGCGAGCATTAGAGACAGTTGAGAGGGTGAATATGGGTAATGAAAGAGTGTCTCCCCAAAATGATACCTTGTGGAGACTTTGGGTTTCTGATGATCCTTATTTGACGCACAATGGTTTTCCTACATTTGTTTCAAAAAAGGAAGCTGTCAAGTACACGACCTGGCCAACGGAGGATATCGCCCCTCCTTCGGTCTATGGCACCGCGACTAAGTTGAACTCGTCGAGAGATCTTAGTCTGAATGCCAATCTGACATGGCATTTTGAAGTTGATCCTGGTTTTGAGTATCTGGTTCGGTTTCACTTCTGTGACATAGTCAGTGAATCTGCTCCACCTGACATAGTCAGTGAATCTGCTCCAACTCCCATCCTCAGAGTTTTTATCAATTCTCTGTTTGTTTCTAATAGTCTTGATCTTAGAAATCTGACCAAAAATATCTTAGGCACCCCATATTTTATGGATGCCATTATGAGGGTAAGTGATAGCAAGAAGCTAACCGTAAGTGTTGGCCCTAATAATCCAGACGCACCTGACTCAGTTGTCTTTCTCAATGGGCTGGAGATCATGAAAATAAGCAATTCTAGGAGCAGCTTGGACTTTGCTTTGAATAAAAGCTCTAAGATGAAAGTTGGTGTTATAGTGGGTTTGGCTGTTGGACTATTCATTGCTATTGTGCTGGCTGCAGTTTTCTTCCTGCTGTGCAGAAGAAGACTAACACATGCCATCCATTCAAGGACAGATGATGTTATGGTGAATGGAATGGAAAGTAAAGACACTGATAGCACAGCGATGTTTTCTGTCTCAAAAATTGGGTATCGCTTTCCTTTCGTGGCAATTCAAGAGGCTACTGATAATTTCAGTGAGAACCTAATTGTTGGGGCTGGTGGTTTTGGGAAAGTTTACAAAGGAGTTTTAAGGGACAACACAAAAGTGGCAGTTAAGAGAGGAGCTTCTCATTCAAGGCAGGGTCGTGCAGAATTTCGGACAGAAATTGAAATGTTGTCTCAGTTCCGCCACCGCCATTTGGTAGCATTAATTGGATACTGTGATGAGAAAAATGAGATGATCGTTATTTATGAGTACATGGAAAATGGGAGCCTGAAGAACTATCTGTATGGCTCAGATTTTCCAAGCTTAAGTTGGAGGCAAAGGCTTGGAATATGTGTTGGAGCTGCCAAGGGACTTCACTATCTTCACACTGGCTCTACAAAGGCAATTATTCACAGGGATGTTAAGTCTGCCAATATTCTACTGGATGAGAATTTTATGGCCAAGGTTGCTGATTTTGGGCTGTCAAAAACTGGTCCTGAGATTGATCAAACGCATGTCAGCACCGCGGTCAAAGGCAGCTTTGGGTATCTTGATCCAGAGTACTTAACAAGGCAACGGCTGACGGAGAAGTCAGATGTGTACTCATTTGGGGTGGTGATGTATGAAGTCCTTTGTGGAAGACCTGTTATTGATCCATCTCTCCCAAGGGAAAAGGTGAACTTAGTTGAATGGGCACTGAAGTGGCAGAAAGATGGGAGATTGGAGGAAATTGTAGACCCCCTTCTTGCAGGTCAAGTAAAGCCGGATTCATTGAAGAAGTTTGGAGAGATAGCTGCAAAATGCTTGGCACAACACAGCGTTGATCGACCTACGGTGGGAGATGTGTTGTGGAACTTAGAATATGTGCTTCAGCTCGAAGGAAACGATGGACGATCAGATCACAATCGCAGGCCATCTATGCAAGCTGATCACGCCAACCACCTGGAGAGCAGTGTATCTAATGCAGAATTTAGCATGGGAAGTGCAGGGGACCTTGCTGGTGTCTCAATGAGCAAGGTCTTTTTCCAGATGGTGAAGGAGGAAATGAGGTAG


Protein sequences

Name Description Sequence
ppa001467m Protein kinase superfamily protein (best arabidopsis hit)

MAGGTIRLLIGVSSILYLICGSLGFNPVDKHLIICGSKTNVKVGDRVFVSDESDSSILSTPQKISGNSSSISSSLDSVLYRSARIFSGTSVYTFPIRKQGRHWVRLYFSPFVHEGYNLSTAKFSVSAQTFTLLKEFKIESGYRMREYSLNITSDSLVLTFTPATNSFAFINALEVVSLPDELIPEDAITIGSKENHQNLRKRALETVERVNMGNERVSPQNDTLWRLWVSDDPYLTHNGFPTFVSKKEAVKYTTWPTEDIAPPSVYGTATKLNSSRDLSLNANLTWHFEVDPGFEYLVRFHFCDIVSESAPPDIVSESAPTPILRVFINSLFVSNSLDLRNLTKNILGTPYFMDAIMRVSDSKKLTVSVGPNNPDAPDSVVFLNGLEIMKISNSRSSLDFALNKSSKMKVGVIVGLAVGLFIAIVLAAVFFLLCRRRLTHAIHSRTDDVMVNGMESKDTDSTAMFSVSKIGYRFPFVAIQEATDNFSENLIVGAGGFGKVYKGVLRDNTKVAVKRGASHSRQGRAEFRTEIEMLSQFRHRHLVALIGYCDEKNEMIVIYEYMENGSLKNYLYGSDFPSLSWRQRLGICVGAAKGLHYLHTGSTKAIIHRDVKSANILLDENFMAKVADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYLTRQRLTEKSDVYSFGVVMYEVLCGRPVIDPSLPREKVNLVEWALKWQKDGRLEEIVDPLLAGQVKPDSLKKFGEIAAKCLAQHSVDRPTVGDVLWNLEYVLQLEGNDGRSDHNRRPSMQADHANHLESSVSNAEFSMGSAGDLAGVSMSKVFFQMVKEEMR*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF785
33-820 SUBFAMILY NOT NAMED

IICGSKTNVKVGDRVFVSDESDSSILSTPQKISGNSSSISSSLDSVLYRSARIFSGTSVYTFPIRKQGRHWVRLYFSPFVHEGYNLSTAKFSVSAQTFTLLKEFKIESGYRMREYSLNITSDSLVLTFTPATNSFAFINALEVVSLPDELIPEDAITIGSKENHQNLRKRALETVERVNMGNERVSPQNDTLWRLWVSDDPYLTHNGFPTFVSKKEAVKYTTWPTEDIAPPSVYGTATKLNSSRDLSLNANLTWHFEVDPGFEYLVRFHFCDIVSESAPPDIVSESAPTPILRVFINSLFVSNSLDLRNLTKNILGTPYFMDAIMRVSDSKKLTVSVGPNNPDAPDSVVFLNGLEIMKISNSRSSLDFALNKSSKMKVGVIVGLAVGLFIAIVLAAVFFLLCRRRLTHAIHSRTDDVMVNGMESKDTDSTAMFSVSKIGYRFPFVAIQEATDNFSENLIVGAGGFGKVYKGVLRDNTKVAVKRGASHSRQGRAEFRTEIEMLSQFRHRHLVALIGYCDEKNEMIVIYEYMENGSLKNYLYGSDFPSLSWRQRLGICVGAAKGLHYLHTGSTKAIIHRDVKSANILLDENFMAKVADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYLTRQRLTEKSDVYSFGVVMYEVLCGRPVIDPSLPREKVNLVEWALKWQKDGRLEEIVDPLLAGQVKPDSLKKFGEIAAKCLAQHSVDRPTVGDVLWNLEYVLQLEGNDGRSDHNRRPSMQADHANHLESSVSNAEFSMGSAGDLAGVSMSKVFFQMVKEEMR

HMMPanther: PTHR24420
33-820 FAMILY NOT NAMED,FAMILY NOT NAMED

IICGSKTNVKVGDRVFVSDESDSSILSTPQKISGNSSSISSSLDSVLYRSARIFSGTSVYTFPIRKQGRHWVRLYFSPFVHEGYNLSTAKFSVSAQTFTLLKEFKIESGYRMREYSLNITSDSLVLTFTPATNSFAFINALEVVSLPDELIPEDAITIGSKENHQNLRKRALETVERVNMGNERVSPQNDTLWRLWVSDDPYLTHNGFPTFVSKKEAVKYTTWPTEDIAPPSVYGTATKLNSSRDLSLNANLTWHFEVDPGFEYLVRFHFCDIVSESAPPDIVSESAPTPILRVFINSLFVSNSLDLRNLTKNILGTPYFMDAIMRVSDSKKLTVSVGPNNPDAPDSVVFLNGLEIMKISNSRSSLDFALNKSSKMKVGVIVGLAVGLFIAIVLAAVFFLLCRRRLTHAIHSRTDDVMVNGMESKDTDSTAMFSVSKIGYRFPFVAIQEATDNFSENLIVGAGGFGKVYKGVLRDNTKVAVKRGASHSRQGRAEFRTEIEMLSQFRHRHLVALIGYCDEKNEMIVIYEYMENGSLKNYLYGSDFPSLSWRQRLGICVGAAKGLHYLHTGSTKAIIHRDVKSANILLDENFMAKVADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYLTRQRLTEKSDVYSFGVVMYEVLCGRPVIDPSLPREKVNLVEWALKWQKDGRLEEIVDPLLAGQVKPDSLKKFGEIAAKCLAQHSVDRPTVGDVLWNLEYVLQLEGNDGRSDHNRRPSMQADHANHLESSVSNAEFSMGSAGDLAGVSMSKVFFQMVKEEMR

HMMPfam: PF12819
IPR024788
34-391 Malectin_like,Carbohydrate-binding protein of the ER
Malectin-like carbohydrate-binding domain

ICGSKTNVKVGDRVFVSDESDSSILSTPQKISGNSSSISSSLDSVLYRSARIFSGTSVYTFPIRKQGRHWVRLYFSPFVHEGYNLSTAKFSVSAQTFTLLKEFKIESGYRMREYSLNITSDSLVLTFTPATNSFAFINALEVVSLPDELIPEDAITIGSKENHQNLRKRALETVERVNMGNERVSPQNDTLWRLWVSDDPYLTHNGFPTFVSKKEAVKYTTWPTEDIAPPSVYGTATKLNSSRDLSLNANLTWHFEVDPGFEYLVRFHFCDIVSESAPPDIVSESAPTPILRVFINSLFVSNSLDLRNLTKNILGTPYFMDAIMRVSDSKKLTVSVGPNNPDAPDSVVFLNGLEIMKI

Seg: seg
65-82 seg

SGNSSSISSSLDSVLYRS

superfamily: SSF56112
IPR011009
456-764 Protein kinase-like (PK-like)
Protein kinase-like domain

SKDTDSTAMFSVSKIGYRFPFVAIQEATDNFSENLIVGAGGFGKVYKGVLRDNTKVAVKRGASHSRQGRAEFRTEIEMLSQFRHRHLVALIGYCDEKNEMIVIYEYMENGSLKNYLYGSDFPSLSWRQRLGICVGAAKGLHYLHTGSTKAIIHRDVKSANILLDENFMAKVADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYLTRQRLTEKSDVYSFGVVMYEVLCGRPVIDPSLPREKVNLVEWALKWQKDGRLEEIVDPLLAGQVKPDSLKKFGEIAAKCLAQHSVDRPTVGDVLWNLEYVLQLEG

Gene3D: G3DSA:3.30.200.20
474-547 no description

FPFVAIQEATDNFSENLIVGAGGFGKVYKGVLRDNTKVAVKRGASHSRQGRAEFRTEIEMLSQFRHRHLVALIG

ProfileScan: PS50011
IPR000719
486-759 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSENLIVGAGGFGKVYKGVLRDNTKVAVKRGASHSRQGRAEFRTEIEMLSQFRHRHLVALIGYCDEKNEMIVIYEYMENGSLKNYLYGSDFPSLSWRQRLGICVGAAKGLHYLHTGSTKAIIHRDVKSANILLDENFMAKVADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYLTRQRLTEKSDVYSFGVVMYEVLCGRPVIDPSLPREKVNLVEWALKWQKDGRLEEIVDPLLAGQVKPDSLKKFGEIAAKCLAQHSVDRPTVGDVLWNLEYV

HMMSmart: SM00220
IPR002290
486-759 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSENLIVGAGGFGKVYKGVLRDNTKVAVKRGASHSRQGRAEFRTEIEMLSQFRHRHLVALIGYCDEKNEMIVIYEYMENGSLKNYLYGSDFPSLSWRQRLGICVGAAKGLHYLHTGSTKAIIHRDVKSANILLDENFMAKVADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYLTRQRLTEKSDVYSFGVVMYEVLCGRPVIDPSLPREKVNLVEWALKWQKDGRLEEIVDPLLAGQVKPDSLKKFGEIAAKCLAQHSVDRPTVGDVLWNLEYV

HMMSmart: SM00219
IPR020635
486-756 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSENLIVGAGGFGKVYKGVLRDNTKVAVKRGASHSRQGRAEFRTEIEMLSQFRHRHLVALIGYCDEKNEMIVIYEYMENGSLKNYLYGSDFPSLSWRQRLGICVGAAKGLHYLHTGSTKAIIHRDVKSANILLDENFMAKVADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYLTRQRLTEKSDVYSFGVVMYEVLCGRPVIDPSLPREKVNLVEWALKWQKDGRLEEIVDPLLAGQVKPDSLKKFGEIAAKCLAQHSVDRPTVGDVLWNL

HMMPfam: PF07714
IPR001245
492-751 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

VGAGGFGKVYKGVLRDNTKVAVKRGASHSRQGRAEFRTEIEMLSQFRHRHLVALIGYCDEKNEMIVIYEYMENGSLKNYLYGSDFPSLSWRQRLGICVGAAKGLHYLHTGSTKAIIHRDVKSANILLDENFMAKVADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYLTRQRLTEKSDVYSFGVVMYEVLCGRPVIDPSLPREKVNLVEWALKWQKDGRLEEIVDPLLAGQVKPDSLKKFGEIAAKCLAQHSVDRPTVGD

PatternScan: PS00107
IPR017441
492-514 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGAGGFGKVYKGVLRDNTKVAVK

Gene3D: G3DSA:1.10.510.10
548-753 no description

YCDEKNEMIVIYEYMENGSLKNYLYGSDFPSLSWRQRLGICVGAAKGLHYLHTGSTKAIIHRDVKSANILLDENFMAKVADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEYLTRQRLTEKSDVYSFGVVMYEVLCGRPVIDPSLPREKVNLVEWALKWQKDGRLEEIVDPLLAGQVKPDSLKKFGEIAAKCLAQHSVDRPTVGDVL

PatternScan: PS00108
IPR008271
606-618 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKSANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox