PRGDB00172489 (ppa026159m)

From PRG Wiki
Jump to: navigation, search
ppa026159m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Prunus persica

Comment?

NB-ARC domain-containing disease resistance protein (best arabidopsis hit)

DNA Sequence

ATGGATATTGTTATTTCAATTGCGTCCAAAATTGCAGAGTCCTTGGTGCGACCAATAGGCAAAGAATTTGGCTATTTGATTTGCTATGATTCCAAGATGAAAGATCTAAAGTATCAACTTCAAAAGCTTTTTGAGATGAAAAATGGGGTGCAAGAATTGGTTAATACTGCCAAAAGGAATGGTGAAGTTATCAACTCTGATGTTCAAAGTTGGCTAACAAGTGTTAACGAGTTAATTCAGAAAGTGTCTCATTTTGAGGAAGAAGTCAACATGAAAAGGCAATGCTTGTACCGGTGGAACATAAGTAGGAAAGCCACTAAGATTACACAAGATGTTCGTCATCTCCAAAAAGAAGGAACATTCAATAATGTTGCCCATCCTGCACCTCCACCAATGATATCGTTAGCATTCAAAGAAGGTTTTAAGGATTTTAAATCCAGAATGACATGTGTGAATAGGGTGATAGAGGTTTTGAAGAATGAAGAAGTTAGAGGGATTGGGATTTGTGGTATGGGGGGTGTGGGTAAAACCACAATGGTGAAAGAAATCATCAAAAGACTGGAAGGATTGAAAGTATTCGATAATATTGTGATGGCAGTTGTGTCCCAATGCCCAAGCATTCAGAAGATTCAATCAGAAATTGCAGAGGAGCTGGGGTTTAAATATGACGAGAATACCGAAAGTGGAAGAGCGCGAAGGCTCTACAGAAGACTCATGGAAATAAATAGCATCTTGATTGTATTAGATGATGTCTGGACAGAGCTTGATTTTGAGGCTATAGGACTTCCTTCTGGACTTTCTCATAAAGGGTGCAAAATTTTGTTGACCTCACGAAACTTGGAAGTGTGCAATGCAATGGGAAGTCAAGAAATTTTTACACTCCCAGTTTTAACAGCAGAAGAATCATGGGAACTCTTCAGTGAAATGGTAGGTAAACCCTTGGACTATCCTGATTTGGCAAAACAAGTCACGAATGAGTGTGGAGGTTTACCTATTGCTATTATAACTGTTGCAAAAGCACTAGAAAATAAGAGGAAGCATGAATGGGTTGATGCACTCAAACAACTACAAAGTTCAGCTCCTGGAAGCATCTCTTCAATGAATGACAGAGTTTATTCAAACATACAATGGAGTTATGATAGATTGGAGAGTGATGAAGCGAAGTCATGCCTTTTGCTTTGTTGTTTATTTCCTGAAGATTATGATATTCCAATTGAGTATTTGGTTAGATATGGATGGGGTCGAGGGTATTTTAGTAACACTGATTTAGTGGAAGAAGCAAGAAATAGAGTGCATTCTTTGGTTGACAAACTTCAAAGAAGGTTTTTATTGCTAGATAGCAAATTGAAAGACCATACCAAGATGCATGACATAGTTCGTGATGTTGCCATACAAATTGCCTCAAGAGATCCACATAGATTTCTAATAAGATGTGATGCTGAAAAGAAAGGGTGGCCAAAGATATACGACCATTACACAACAATCTCACTGATACCAATTAATATTGATGAGATCCCAGTTGGTCTGGAGTGTCCAAAACTTGAGCTTCTACACTTAGAAGGCAAATGTTATTCGGAAAATAGCATGGACATCATGTGTAAGGGGATGAAAGAGTTAAAGGTTTTAGGCATGGGTGGGATATCAGCCTTGCCAAGTTCACAAGGACTACTGAAGAGCCTTCGAACCTTGTCCCTAAATGGTTGTCGTTATTTAACAGATATATCTGATGTTATTGGAAGATTGGAAAATTTAGAGATCCTCAGCTTTCGTGAATGCATTAACATCTTAGAGTTGCCAAGGGAAATTGGACTTCTTAAACATTTAAAGTTGTTAGATATTACGGATTGTATTCGTCTTCAGAAGATTCCACATGGTCTTTTATCGAGCTTATCTAGTCTTGAAGAGTTGTATATGGAAAATAGTTTTCGCAAATGGGAACGATCAGCAGCAGAAAGCGAAGATAAGAGGATGGCAAGCCTTGTTGAGGTGATGTCTTTGTCTAATCATTTGAAGATTCAACTCTTATTTAAGAAATGTGAAGATTTAATCTTGGGAAGGATTAAGAATTTAAAGTGTGTCCTCAATGAATTAGACCAAGAGGGACTGCAACACTTAAAAGTTTTAACAATTTGGGACTGCCGTGAGATAGAATACCTGGTAAATGGAGCGAGTTGGACTCAACAAACAGCCTTCCCTCTCATTCAGTCAATCCAACTCATGTGGATTCCCAAGCTAAAAGCAATATGCCACGACCAACTCCCACAGAGCTCTTTTATCAACTTAAGATCTCTTGAATTATATGATTGCCCTGTTTTAAAATATGTGTTTTCTCTATCAGTAGCAAGCAACTTGGTTCAACTTCAAAGCTTAAATGTTGACCGGTGTCGCCAAATGAAAGAAATCGTCTCAAAGGAGTGGAGGGAACATGAGACGGCATCGGACATCATAGCTTTCCCTAAATTAACAAATTTGACACTCCAAGTCTTTGTGCCTCAATTTTTTTTTTTTTTTTGTGGGTCTGAATTTAGGTTGACTGTTTGTTTGATGCACGTATGGGAAACGGGAGGTTCACAACATATCACAGGCTTCGGAAACTTGACATTCTTAAGTGTATCCCACTGTGGCAGTTTACGATATTTGTTCTTGTCAACTGTAGCCAAGCTCCTTGTCAGTTTGAAGGACTTAAAAGTTGGGAATTGTAAGAAGATTAAACAAGTTATTGCAAAAGCAGACACTGAATGTGCTGATCAGGAAATTACATTTCCTCAATTGAATTCCATGACGCTTGAAGATCTACCAAACCTCATTTGTTTCTCTACTGAAGCTTATACTTTGAAGTTGCCATCTTTGATGAAATTGAAGGTTATAAGATGTCCATACTTAAGAACATTTGCTTCTAAGGTTGTCAACACACATTCTAGAATCCAAGTACACACAGAGTTGGGACAATCTGAGTGGATGGGGGAACTCAATAGCACTATAGGGAACATTCACAAAAAA


Protein sequences

Name Description Sequence
ppa026159m NB-ARC domain-containing disease resistance protein (best arabidopsis hit)

MDIVISIASKIAESLVRPIGKEFGYLICYDSKMKDLKYQLQKLFEMKNGVQELVNTAKRNGEVINSDVQSWLTSVNELIQKVSHFEEEVNMKRQCLYRWNISRKATKITQDVRHLQKEGTFNNVAHPAPPPMISLAFKEGFKDFKSRMTCVNRVIEVLKNEEVRGIGICGMGGVGKTTMVKEIIKRLEGLKVFDNIVMAVVSQCPSIQKIQSEIAEELGFKYDENTESGRARRLYRRLMEINSILIVLDDVWTELDFEAIGLPSGLSHKGCKILLTSRNLEVCNAMGSQEIFTLPVLTAEESWELFSEMVGKPLDYPDLAKQVTNECGGLPIAIITVAKALENKRKHEWVDALKQLQSSAPGSISSMNDRVYSNIQWSYDRLESDEAKSCLLLCCLFPEDYDIPIEYLVRYGWGRGYFSNTDLVEEARNRVHSLVDKLQRRFLLLDSKLKDHTKMHDIVRDVAIQIASRDPHRFLIRCDAEKKGWPKIYDHYTTISLIPINIDEIPVGLECPKLELLHLEGKCYSENSMDIMCKGMKELKVLGMGGISALPSSQGLLKSLRTLSLNGCRYLTDISDVIGRLENLEILSFRECINILELPREIGLLKHLKLLDITDCIRLQKIPHGLLSSLSSLEELYMENSFRKWERSAAESEDKRMASLVEVMSLSNHLKIQLLFKKCEDLILGRIKNLKCVLNELDQEGLQHLKVLTIWDCREIEYLVNGASWTQQTAFPLIQSIQLMWIPKLKAICHDQLPQSSFINLRSLELYDCPVLKYVFSLSVASNLVQLQSLNVDRCRQMKEIVSKEWREHETASDIIAFPKLTNLTLQVFVPQFFFFFCGSEFRLTVCLMHVWETGGSQHITGFGNLTFLSVSHCGSLRYLFLSTVAKLLVSLKDLKVGNCKKIKQVIAKADTECADQEITFPQLNSMTLEDLPNLICFSTEAYTLKLPSLMKLKVIRCPYLRTFASKVVNTHSRIQVHTELGQSEWMGELNSTIGNIHKK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
1-998 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDIVISIASKIAESLVRPIGKEFGYLICYDSKMKDLKYQLQKLFEMKNGVQELVNTAKRNGEVINSDVQSWLTSVNELIQKVSHFEEEVNMKRQCLYRWNISRKATKITQDVRHLQKEGTFNNVAHPAPPPMISLAFKEGFKDFKSRMTCVNRVIEVLKNEEVRGIGICGMGGVGKTTMVKEIIKRLEGLKVFDNIVMAVVSQCPSIQKIQSEIAEELGFKYDENTESGRARRLYRRLMEINSILIVLDDVWTELDFEAIGLPSGLSHKGCKILLTSRNLEVCNAMGSQEIFTLPVLTAEESWELFSEMVGKPLDYPDLAKQVTNECGGLPIAIITVAKALENKRKHEWVDALKQLQSSAPGSISSMNDRVYSNIQWSYDRLESDEAKSCLLLCCLFPEDYDIPIEYLVRYGWGRGYFSNTDLVEEARNRVHSLVDKLQRRFLLLDSKLKDHTKMHDIVRDVAIQIASRDPHRFLIRCDAEKKGWPKIYDHYTTISLIPINIDEIPVGLECPKLELLHLEGKCYSENSMDIMCKGMKELKVLGMGGISALPSSQGLLKSLRTLSLNGCRYLTDISDVIGRLENLEILSFRECINILELPREIGLLKHLKLLDITDCIRLQKIPHGLLSSLSSLEELYMENSFRKWERSAAESEDKRMASLVEVMSLSNHLKIQLLFKKCEDLILGRIKNLKCVLNELDQEGLQHLKVLTIWDCREIEYLVNGASWTQQTAFPLIQSIQLMWIPKLKAICHDQLPQSSFINLRSLELYDCPVLKYVFSLSVASNLVQLQSLNVDRCRQMKEIVSKEWREHETASDIIAFPKLTNLTLQVFVPQFFFFFCGSEFRLTVCLMHVWETGGSQHITGFGNLTFLSVSHCGSLRYLFLSTVAKLLVSLKDLKVGNCKKIKQVIAKADTECADQEITFPQLNSMTLEDLPNLICFSTEAYTLKLPSLMKLKVIRCPYLRTFASKVVNTHSRIQVHTELGQSEWMGELNSTIGNIH

HMMPanther: PTHR23155
1-998 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MDIVISIASKIAESLVRPIGKEFGYLICYDSKMKDLKYQLQKLFEMKNGVQELVNTAKRNGEVINSDVQSWLTSVNELIQKVSHFEEEVNMKRQCLYRWNISRKATKITQDVRHLQKEGTFNNVAHPAPPPMISLAFKEGFKDFKSRMTCVNRVIEVLKNEEVRGIGICGMGGVGKTTMVKEIIKRLEGLKVFDNIVMAVVSQCPSIQKIQSEIAEELGFKYDENTESGRARRLYRRLMEINSILIVLDDVWTELDFEAIGLPSGLSHKGCKILLTSRNLEVCNAMGSQEIFTLPVLTAEESWELFSEMVGKPLDYPDLAKQVTNECGGLPIAIITVAKALENKRKHEWVDALKQLQSSAPGSISSMNDRVYSNIQWSYDRLESDEAKSCLLLCCLFPEDYDIPIEYLVRYGWGRGYFSNTDLVEEARNRVHSLVDKLQRRFLLLDSKLKDHTKMHDIVRDVAIQIASRDPHRFLIRCDAEKKGWPKIYDHYTTISLIPINIDEIPVGLECPKLELLHLEGKCYSENSMDIMCKGMKELKVLGMGGISALPSSQGLLKSLRTLSLNGCRYLTDISDVIGRLENLEILSFRECINILELPREIGLLKHLKLLDITDCIRLQKIPHGLLSSLSSLEELYMENSFRKWERSAAESEDKRMASLVEVMSLSNHLKIQLLFKKCEDLILGRIKNLKCVLNELDQEGLQHLKVLTIWDCREIEYLVNGASWTQQTAFPLIQSIQLMWIPKLKAICHDQLPQSSFINLRSLELYDCPVLKYVFSLSVASNLVQLQSLNVDRCRQMKEIVSKEWREHETASDIIAFPKLTNLTLQVFVPQFFFFFCGSEFRLTVCLMHVWETGGSQHITGFGNLTFLSVSHCGSLRYLFLSTVAKLLVSLKDLKVGNCKKIKQVIAKADTECADQEITFPQLNSMTLEDLPNLICFSTEAYTLKLPSLMKLKVIRCPYLRTFASKVVNTHSRIQVHTELGQSEWMGELNSTIGNIH

Gene3D: G3DSA:3.40.50.300
138-251 no description

KEGFKDFKSRMTCVNRVIEVLKNEEVRGIGICGMGGVGKTTMVKEIIKRLEGLKVFDNIVMAVVSQCPSIQKIQSEIAEELGFKYDENTESGRARRLYRRLMEINSILIVLDDV

HMMPfam: PF00931
IPR002182
150-411 NB-ARC,NBS
NB-ARC

CVNRVIEVLKNEEVRGIGICGMGGVGKTTMVKEIIKRLEGLKVFDNIVMAVVSQCPSIQKIQSEIAEELGFKYDENTESGRARRLYRRLMEINSILIVLDDVWTELDFEAIGLPSGLSHKGCKILLTSRNLEVCNAMGSQEIFTLPVLTAEESWELFSEMVGKPLDYPDLAKQVTNECGGLPIAIITVAKALENKRKHEWVDALKQLQSSAPGSISSMNDRVYSNIQWSYDRLESDEAKSCLLLCCLFPEDYDIPIEYLVRY

superfamily: SSF52540
151-364 P-loop containing nucleoside triphosphate hydrolases

VNRVIEVLKNEEVRGIGICGMGGVGKTTMVKEIIKRLEGLKVFDNIVMAVVSQCPSIQKIQSEIAEELGFKYDENTESGRARRLYRRLMEINSILIVLDDVWTELDFEAIGLPSGLSHKGCKILLTSRNLEVCNAMGSQEIFTLPVLTAEESWELFSEMVGKPLDYPDLAKQVTNECGGLPIAIITVAKALENKRKHEWVDALKQLQSSAPGSI

Seg: seg
165-175 seg

GIGICGMGGVG

FPrintScan: PR00364
IPR000767
165-180 DISEASERSIST
Disease resistance protein

GIGICGMGGVGKTTMV

FPrintScan: PR00364
IPR000767
238-252 DISEASERSIST
Disease resistance protein

LMEINSILIVLDDVW

FPrintScan: PR00364
IPR000767
327-341 DISEASERSIST
Disease resistance protein

CGGLPIAIITVAKAL

Gene3D: G3DSA:3.80.10.10
454-639 no description

KMHDIVRDVAIQIASRDPHRFLIRCDAEKKGWPKIYDHYTTISLIPINIDEIPVGLECPKLELLHLEGKCYSENSMDIMCKGMKELKVLGMGGISALPSSQGLLKSLRTLSLNGCRYLTDISDVIGRLENLEILSFRECINILELPREIGLLKHLKLLDITDCIRLQKIPHGLLSSLSSLEELYME

superfamily: SSF52058
454-827 L domain-like,LRR

KMHDIVRDVAIQIASRDPHRFLIRCDAEKKGWPKIYDHYTTISLIPINIDEIPVGLECPKLELLHLEGKCYSENSMDIMCKGMKELKVLGMGGISALPSSQGLLKSLRTLSLNGCRYLTDISDVIGRLENLEILSFRECINILELPREIGLLKHLKLLDITDCIRLQKIPHGLLSSLSSLEELYMENSFRKWERSAAESEDKRMASLVEVMSLSNHLKIQLLFKKCEDLILGRIKNLKCVLNELDQEGLQHLKVLTIWDCREIEYLVNGASWTQQTAFPLIQSIQLMWIPKLKAICHDQLPQSSFINLRSLELYDCPVLKYVFSLSVASNLVQLQSLNVDRCRQMKEIVSKEWREHETASDIIAFPKLTNLTLQ

FPrintScan: PR00364
IPR000767
555-571 DISEASERSIST
Disease resistance protein

GLLKSLRTLSLNGCRYL

HMMPfam: PF13504
559-574 LRR_7,Leucine rich repeat

SLRTLSLNGCRYLTDI

HMMPfam: PF00560
IPR001611
607-630 LRR_1
Leucine-rich repeat

HLKLLDITDCIRLQKIPHGLLSSL

Seg: seg
626-636 seg

LLSSLSSLEEL

Gene3D: G3DSA:3.40.50.300
640-667 no description

NSFRKWERSAAESEDKRMASLVEVMSLS

Gene3D: G3DSA:3.80.10.10
695-959 no description

NELDQEGLQHLKVLTIWDCREIEYLVNGASWTQQTAFPLIQSIQLMWIPKLKAICHDQLPQSSFINLRSLELYDCPVLKYVFSLSVASNLVQLQSLNVDRCRQMKEIVSKEWREHETASDIIAFPKLTNLTLQVFVPQFFFFFCGSEFRLTVCLMHVWETGGSQHITGFGNLTFLSVSHCGSLRYLFLSTVAKLLVSLKDLKVGNCKKIKQVIAKADTECADQEITFPQLNSMTLEDLPNLICFSTEAYTLKLPSLMKLKVIRCP

Seg: seg
827-837 seg

QVFVPQFFFFF

superfamily: SSF52047
830-964 RNI-like,LRR

VPQFFFFFCGSEFRLTVCLMHVWETGGSQHITGFGNLTFLSVSHCGSLRYLFLSTVAKLLVSLKDLKVGNCKKIKQVIAKADTECADQEITFPQLNSMTLEDLPNLICFSTEAYTLKLPSLMKLKVIRCPYLRTF

HMMPfam: PF13504
864-879 LRR_7,Leucine rich repeat

GNLTFLSVSHCGSLRY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox