PRGDB00172490 (ppa023165m)

From PRG Wiki
Jump to: navigation, search
ppa023165m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Prunus persica

Comment?

disease resistance protein (TIR-NBS-LRR class), putative (best arabidopsis hit)

DNA Sequence

ATGCCAACCACACCTTCTCTCTCTTTTTTCCTATGTGGACTGCTTCTAGCTGTGTCAAAAATTCAAAGAAAAGATACAGTTTTTCGATGGGTTTTAATTTTGTATGAAACCTTGCTCATCAAAGATATAATCGATGTGATATGGAAAAGATTACGTCCTACATCGTTCACTTCTGTGGAGAACTCAGTTGGATTAGACTCAAGTATGAACTCAATTGATTTATTGTTAGGTGCAGGGGTTGATGATGTTCGCTTTATAGGGATATGGGGTATGGGTGGGATTGGTAAAACAACTATTGCCAGAGTTGTTCGCGAGAGAATCTCTCCTGAATTTGAATTGAGCATATTTCTTGAGAATGTCAGTGATAATGTTCAAAAAGGATCTACAATGATTAGAAGATTATTTCATCACAAAAAGGTTCTTCTCATTCTCGATGATGTGACGATCTCAGACCATTTAGATTATTTGGCTGGAAAGCAAGAGTGGTTTGGCTCTGGGAGTAGAGTTCTTATTACAACTAGAAATGAGCATTTGTTAGTTGAACATGGAGTGGAGAGAAGATTTCATGTCAAACGTCTAAATCATGATGACGCTCTTAAGCTTTTTACTCTTAAAGTTTTGGGGAGTTTTTTGCGTGGAAGACATGTAACTGCTTGGAACAGTGCGTTGGGTAAATTAAGGGATCTTTGTAACACAGTTTTGGGGACACTTCAAATAAGTTACGATGATCTAGATGACAAGGAGAAGAAAATTTTCCTAGACATTGCGTGTTTCTTTAACGGGGAGAAAAAAGATCGAGTTATAGAAATCCTAGACAGTTGCGGCTTTTGTGCAAGTATTGGAATAGATGTCATCATTGAGAAATCTCTGTTAACTAATTCATATGGCACTCTATGGATGCATCGGTTGCTCCAAGAGATGGGTCGTGAAATAGTCAATCGAGAGTGTCTTGATGAGCCAGGAAATCGCAGCAGGTTGTGGTGCCATGAAGAGGCCAAGCATGTGTTGAGCAAAAATACAGGAACAGATGCAGTAGAAAGTATAACCATGGACAAAACTGGGCCAGTGGTGCACGGGGATGCTAAATGCTTTTCAAGGATGAAGAAACTGAGACTTCTCAATCTTGCTAATGCGAACCTCTCTAATGATCTTGAATATCTCTCTGATAATTTACGAAGTCTTGAATGGGCTGGGTATCCTTCAAAATATTTCCCGTCACATTTCAACCCAGAGAACCTACTAGAACTTAACATGTGCCATAGTCACATTGAATCTTTTTGGACGGGTGTTAAGATTTTATACAATTTGAAAGTCATTAAGCTCAGCCACTCTTTGAATCTTGTCAACACCCCAGACTTTAGAGGCTTTCCAAATCTTGAGTATCTGATTCTGGAAGGTTGTATACGATTGTATAAGGTTGACCCATCCCTTGGAATGCTTGAAAAAATTACTCAGGTAAACTTGAAGGATTGCAAAAGTCTTGTGCATCTTCCAAGAAGTGTGTATGGCTTAAAATCTGTCAAAGTTCTTAATCTCTCTGGCTGCTCAAAGCTCGAAAAGTTGCCCAATGAGTTGGGCAATGCAGAGTGTTTGGAGGAGCTTGATGTGAGTGGAACTGCCATAAGACAACTGCCTTCCTCCGTTGTTCAGTTGAAAAGCCTCACAGTATTTAACTTTCGTGGATCGATTTCTAATAAGAAGTCGCGTTCCCACTCCTTTGTTGCTGCCCTCTCTATCTGGTTTGGTTTCCTTTTAAAAAAACTTATTCTAAGTGATTGCAATCTCTTGGAAGTCCCTAATGACCTTAGCTGCTTGTCCTCATTAACCGACCTAGATCTCAGTAGAAACCAGTTTGTTAGCCTACCCAACGGCATCTCTCTACTTTCTAGACTTCAATTTCTTAACTTGGAGTATTGCGAGAGGCTTCAAGAATTGCCAGAGGTTCCACAAACAGTAATAGTAGTTGTTGATAACTGTATTTCATTAGAAAGAATTGCTAGAGGCTCCACAGAAAGGTGCAAGTTGCTGTTACGGACACAATGTATCAACTGCTTCAAATTTGCGGAGATGCACGATTTTAGAAGTTTGGAAGTCCCTATTACTCAAGACGTATTTCAATTTGTTGTTCCTGGAAATGAAATTCCCGAGTGGTTCAATCATAAATCTGCTCAATATATATACAATGAGGAGGAGTGGTTCAATCCTCAAAGTGTGGAGTATCCATTAAGTGTGCAGCTACGTCCAGGTTGGTTTACTGAAAAATGGATGGGATTCGCGGTGTGCATTGCTTTTGCAATCCAGGAACGATCACCTAATTGCGACCATGCTCTTAAGTATACTAGATATGATTACAATTATACACATATTATTACTTGCAAAGTGGACATCAATGGAAAGGAGATGACGGCACGTAGGCGTCCATTTGTGTTTCTCAATGCAGAGTTGGGCCAAGCTGTGTCTGATCACCTTTCGGTACTCTTTTTTCCTCGTCACTTTCCGCAGTTGTGGAAGGGTATCATCGATCAGGTTAAATTACCTTCTGGCAAAGAGTGGTGGCAAGGTATATTTGGTCAAATTACATTTTCAATTATGGCCAGAGTAGGCCATGGAGTAATAGTGAAGCAGTGTGCAGCTCGTCTAGTGTACGAGGGAGACTTGGAAGAGCTTGACCCAAGATTTAGCCACCGGACCCGAAGCAATGTCAGCATTTCTGAGGTGGATTCAGAATTCCCCTCTTATACAAACAACTAG


Protein sequences

Name Description Sequence
ppa023165m disease resistance protein (TIR-NBS-LRR class), putative (best arabidopsis hit)

MPTTPSLSFFLCGLLLAVSKIQRKDTVFRWVLILYETLLIKDIIDVIWKRLRPTSFTSVENSVGLDSSMNSIDLLLGAGVDDVRFIGIWGMGGIGKTTIARVVRERISPEFELSIFLENVSDNVQKGSTMIRRLFHHKKVLLILDDVTISDHLDYLAGKQEWFGSGSRVLITTRNEHLLVEHGVERRFHVKRLNHDDALKLFTLKVLGSFLRGRHVTAWNSALGKLRDLCNTVLGTLQISYDDLDDKEKKIFLDIACFFNGEKKDRVIEILDSCGFCASIGIDVIIEKSLLTNSYGTLWMHRLLQEMGREIVNRECLDEPGNRSRLWCHEEAKHVLSKNTGTDAVESITMDKTGPVVHGDAKCFSRMKKLRLLNLANANLSNDLEYLSDNLRSLEWAGYPSKYFPSHFNPENLLELNMCHSHIESFWTGVKILYNLKVIKLSHSLNLVNTPDFRGFPNLEYLILEGCIRLYKVDPSLGMLEKITQVNLKDCKSLVHLPRSVYGLKSVKVLNLSGCSKLEKLPNELGNAECLEELDVSGTAIRQLPSSVVQLKSLTVFNFRGSISNKKSRSHSFVAALSIWFGFLLKKLILSDCNLLEVPNDLSCLSSLTDLDLSRNQFVSLPNGISLLSRLQFLNLEYCERLQELPEVPQTVIVVVDNCISLERIARGSTERCKLLLRTQCINCFKFAEMHDFRSLEVPITQDVFQFVVPGNEIPEWFNHKSAQYIYNEEEWFNPQSVEYPLSVQLRPGWFTEKWMGFAVCIAFAIQERSPNCDHALKYTRYDYNYTHIITCKVDINGKEMTARRRPFVFLNAELGQAVSDHLSVLFFPRHFPQLWKGIIDQVKLPSGKEWWQGIFGQITFSIMARVGHGVIVKQCAARLVYEGDLEELDPRFSHRTRSNVSISEVDSEFPSYTNN*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
21-734 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IQRKDTVFRWVLILYETLLIKDIIDVIWKRLRPTSFTSVENSVGLDSSMNSIDLLLGAGVDDVRFIGIWGMGGIGKTTIARVVRERISPEFELSIFLENVSDNVQKGSTMIRRLFHHKKVLLILDDVTISDHLDYLAGKQEWFGSGSRVLITTRNEHLLVEHGVERRFHVKRLNHDDALKLFTLKVLGSFLRGRHVTAWNSALGKLRDLCNTVLGTLQISYDDLDDKEKKIFLDIACFFNGEKKDRVIEILDSCGFCASIGIDVIIEKSLLTNSYGTLWMHRLLQEMGREIVNRECLDEPGNRSRLWCHEEAKHVLSKNTGTDAVESITMDKTGPVVHGDAKCFSRMKKLRLLNLANANLSNDLEYLSDNLRSLEWAGYPSKYFPSHFNPENLLELNMCHSHIESFWTGVKILYNLKVIKLSHSLNLVNTPDFRGFPNLEYLILEGCIRLYKVDPSLGMLEKITQVNLKDCKSLVHLPRSVYGLKSVKVLNLSGCSKLEKLPNELGNAECLEELDVSGTAIRQLPSSVVQLKSLTVFNFRGSISNKKSRSHSFVAALSIWFGFLLKKLILSDCNLLEVPNDLSCLSSLTDLDLSRNQFVSLPNGISLLSRLQFLNLEYCERLQELPEVPQTVIVVVDNCISLERIARGSTERCKLLLRTQCINCFKFAEMHDFRSLEVPITQDVFQFVVPGNEIPEWFNHKSAQYIYNEEEWFN

HMMPanther: PTHR11017
21-734 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IQRKDTVFRWVLILYETLLIKDIIDVIWKRLRPTSFTSVENSVGLDSSMNSIDLLLGAGVDDVRFIGIWGMGGIGKTTIARVVRERISPEFELSIFLENVSDNVQKGSTMIRRLFHHKKVLLILDDVTISDHLDYLAGKQEWFGSGSRVLITTRNEHLLVEHGVERRFHVKRLNHDDALKLFTLKVLGSFLRGRHVTAWNSALGKLRDLCNTVLGTLQISYDDLDDKEKKIFLDIACFFNGEKKDRVIEILDSCGFCASIGIDVIIEKSLLTNSYGTLWMHRLLQEMGREIVNRECLDEPGNRSRLWCHEEAKHVLSKNTGTDAVESITMDKTGPVVHGDAKCFSRMKKLRLLNLANANLSNDLEYLSDNLRSLEWAGYPSKYFPSHFNPENLLELNMCHSHIESFWTGVKILYNLKVIKLSHSLNLVNTPDFRGFPNLEYLILEGCIRLYKVDPSLGMLEKITQVNLKDCKSLVHLPRSVYGLKSVKVLNLSGCSKLEKLPNELGNAECLEELDVSGTAIRQLPSSVVQLKSLTVFNFRGSISNKKSRSHSFVAALSIWFGFLLKKLILSDCNLLEVPNDLSCLSSLTDLDLSRNQFVSLPNGISLLSRLQFLNLEYCERLQELPEVPQTVIVVVDNCISLERIARGSTERCKLLLRTQCINCFKFAEMHDFRSLEVPITQDVFQFVVPGNEIPEWFNHKSAQYIYNEEEWFN

superfamily: SSF52540
45-231 P-loop containing nucleoside triphosphate hydrolases

DVIWKRLRPTSFTSVENSVGLDSSMNSIDLLLGAGVDDVRFIGIWGMGGIGKTTIARVVRERISPEFELSIFLENVSDNVQKGSTMIRRLFHHKKVLLILDDVTISDHLDYLAGKQEWFGSGSRVLITTRNEHLLVEHGVERRFHVKRLNHDDALKLFTLKVLGSFLRGRHVTAWNSALGKLRDLCN

HMMPfam: PF00931
IPR002182
75-119 NB-ARC,NBS
NB-ARC

LLGAGVDDVRFIGIWGMGGIGKTTIARVVRERISPEFELSIFLEN

FPrintScan: PR00364
IPR000767
85-100 DISEASERSIST
Disease resistance protein

FIGIWGMGGIGKTTIA

HMMPfam: PF00931
IPR002182
120-207 NB-ARC,NBS
NB-ARC

VSDNVQKGSTMIRRLFHHKKVLLILDDVTISDHLDYLAGKQEWFGSGSRVLITTRNEHLLVEHGVERRFHVKRLNHDDALKLFTLKVL

superfamily: SSF52058
311-664 L domain-like,LRR

IVNRECLDEPGNRSRLWCHEEAKHVLSKNTGTDAVESITMDKTGPVVHGDAKCFSRMKKLRLLNLANANLSNDLEYLSDNLRSLEWAGYPSKYFPSHFNPENLLELNMCHSHIESFWTGVKILYNLKVIKLSHSLNLVNTPDFRGFPNLEYLILEGCIRLYKVDPSLGMLEKITQVNLKDCKSLVHLPRSVYGLKSVKVLNLSGCSKLEKLPNELGNAECLEELDVSGTAIRQLPSSVVQLKSLTVFNFRGSISNKKSRSHSFVAALSIWFGFLLKKLILSDCNLLEVPNDLSCLSSLTDLDLSRNQFVSLPNGISLLSRLQFLNLEYCERLQELPEVPQTVIVVVDNCISLER

Gene3D: G3DSA:3.80.10.10
360-560 no description

DAKCFSRMKKLRLLNLANANLSNDLEYLSDNLRSLEWAGYPSKYFPSHFNPENLLELNMCHSHIESFWTGVKILYNLKVIKLSHSLNLVNTPDFRGFPNLEYLILEGCIRLYKVDPSLGMLEKITQVNLKDCKSLVHLPRSVYGLKSVKVLNLSGCSKLEKLPNELGNAECLEELDVSGTAIRQLPSSVVQLKSLTVFNFR

ProfileScan: PS51450
IPR001611
369-391 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRLLNLANANLSNDLEYLSDNL

Seg: seg
370-384 seg

LRLLNLANANLSNDL

HMMPfam: PF07725
IPR011713
412-431 LRR_3
Leucine-rich repeat 3

NLLELNMCHSHIESFWTGVK

FPrintScan: PR00364
IPR000767
502-518 DISEASERSIST
Disease resistance protein

YGLKSVKVLNLSGCSKL

HMMSmart: SM00369
IPR003591
504-528 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKSVKVLNLSGCSKLEKLPNELGNA

HMMPfam: PF00560
IPR001611
507-527 LRR_1
Leucine-rich repeat

VKVLNLSGCSKLEKLPNELGN

HMMSmart: SM00369
IPR003591
529-551 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

ECLEELDVSGTAIRQLPSSVVQL

ProfileScan: PS51450
IPR001611
530-551 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

CLEELDVSGTAIRQLPSSVVQL

ProfileScan: PS51450
IPR001611
584-605 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLKKLILSDCNLLEVPNDLSCL

Gene3D: G3DSA:3.80.10.10
585-649 no description

LKKLILSDCNLLEVPNDLSCLSSLTDLDLSRNQFVSLPNGISLLSRLQFLNLEYCERLQELPEVP

Seg: seg
601-614 seg

DLSCLSSLTDLDLS

HMMSmart: SM00369
IPR003591
605-628 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLTDLDLSRNQFVSLPNGISLL

HMMPfam: PF13504
606-622 LRR_7,Leucine rich repeat

SSLTDLDLSRNQFVSLP

ProfileScan: PS51450
IPR001611
607-628 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTDLDLSRNQFVSLPNGISLL

HMMPfam: PF13504
629-646 LRR_7,Leucine rich repeat

SRLQFLNLEYCERLQELP

ProfileScan: PS51450
IPR001611
630-652 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLQFLNLEYCERLQELPEVPQTV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox