PRGDB00172499 (ppa023700m)

From PRG Wiki
Jump to: navigation, search
ppa023700m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGTCAGCGTCTCTTGCAGCAATATTAGGAGGTGCTGCAGGAGCCGTGACTTTGGTGGGCATAACTATCATACTCATATGGTTCTGTCTATCTCACAATAGGAGTGTATCCAGAACTTCAGAAACAGGTTCTTCTGATCCATCTGTTCAAGTGGGAAGACATGCTGGGGTTGAGTTGTCAATGCGAGAAACAAGGCGTTTTCAGATGGAAGAATTGTCTCTAGCCACAAAAAATTTCAGTGATACAAACTTGATTGGGGAAGGAAAATTTGGGGAGGTATACATGGGTTTTCTTCAAGATGGGATGCTTGTAGCCATCAAAAGGCGACCTGGAACACCTAGTCAGGAATTTATCAATGAGGTACACTATCTCTCAGCTATTCAGCATCGGCATATTGTTACTCTGTTGGGTTACTGCCAGGAAAATAATCTACAGTTTCTTGTGTACGAGTATATTCATAGTGGAAGTGTTTCCAGTCACCTGTATGGCACTGGTCAGCATTCACGTAAAAAGCTAGAATTCAAGAACCGACTATCAATAGCTCTAGGGGCAGCTAAAGGTTTGGCTCATCTTCACTCTTTGAGTCCCCGTCTGGTGCATAAAGATTTCAAAACAGCCAATGTTCTTGTAGATGAAGATCTACTAGCTAAGGTTGCAGATGCAGGAATCCGCAATTTCCTTGGAAGAGTTGATATTGCAGGCCCATCTTCTCAAGTGACTGCTGATGAGATGTTCCTTGCTCCAGAGGTGAGAGAGTTTAGACGATTTTCGGAGAAAAGTGACATATATAGCTTTGGTGTATTCCTTCTGGAGTTAGTAAGTGGGCGAGAAGCAGGAGAATTGGCATCTTCCGACTCAAACCAGAACCTGGTTGAATGGGTGCAAAACATCCAAGATAATAGCAATGTTTCGTGCATCATCGATGAGAGATTGGGGAATAGCTTCACAGGTGAAGCTATGGAAGGGTTCATACACTTGATTATGCGATGTTTGGAACCTTCAAGTGAGAGGCGACCAGCCATGAGCCATGTGGTAATGGAGCTAGATCGAATACACGAGAAAGAGATTAGCTTGACAACAATAATGGGGGAAGGACCCTCCACTGTGATCCCAGGAAGTCAGTTATTTAGAGCGACAAAATAA


Protein sequences

Name Description Sequence
ppa023700m Protein kinase superfamily protein (best arabidopsis hit)

MSASLAAILGGAAGAVTLVGITIILIWFCLSHNRSVSRTSETGSSDPSVQVGRHAGVELSMRETRRFQMEELSLATKNFSDTNLIGEGKFGEVYMGFLQDGMLVAIKRRPGTPSQEFINEVHYLSAIQHRHIVTLLGYCQENNLQFLVYEYIHSGSVSSHLYGTGQHSRKKLEFKNRLSIALGAAKGLAHLHSLSPRLVHKDFKTANVLVDEDLLAKVADAGIRNFLGRVDIAGPSSQVTADEMFLAPEVREFRRFSEKSDIYSFGVFLLELVSGREAGELASSDSNQNLVEWVQNIQDNSNVSCIIDERLGNSFTGEAMEGFIHLIMRCLEPSSERRPAMSHVVMELDRIHEKEISLTTIMGEGPSTVIPGSQLFRATK*

Domains

Domain Start-End Description Sequence

Seg: seg
2-22 seg

SASLAAILGGAAGAVTLVGIT

HMMPanther: PTHR24420
7-364 FAMILY NOT NAMED,FAMILY NOT NAMED

AILGGAAGAVTLVGITIILIWFCLSHNRSVSRTSETGSSDPSVQVGRHAGVELSMRETRRFQMEELSLATKNFSDTNLIGEGKFGEVYMGFLQDGMLVAIKRRPGTPSQEFINEVHYLSAIQHRHIVTLLGYCQENNLQFLVYEYIHSGSVSSHLYGTGQHSRKKLEFKNRLSIALGAAKGLAHLHSLSPRLVHKDFKTANVLVDEDLLAKVADAGIRNFLGRVDIAGPSSQVTADEMFLAPEVREFRRFSEKSDIYSFGVFLLELVSGREAGELASSDSNQNLVEWVQNIQDNSNVSCIIDERLGNSFTGEAMEGFIHLIMRCLEPSSERRPAMSHVVMELDRIHEKEISLTTIMGE

HMMPanther: PTHR24420:SF451
7-364 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

AILGGAAGAVTLVGITIILIWFCLSHNRSVSRTSETGSSDPSVQVGRHAGVELSMRETRRFQMEELSLATKNFSDTNLIGEGKFGEVYMGFLQDGMLVAIKRRPGTPSQEFINEVHYLSAIQHRHIVTLLGYCQENNLQFLVYEYIHSGSVSSHLYGTGQHSRKKLEFKNRLSIALGAAKGLAHLHSLSPRLVHKDFKTANVLVDEDLLAKVADAGIRNFLGRVDIAGPSSQVTADEMFLAPEVREFRRFSEKSDIYSFGVFLLELVSGREAGELASSDSNQNLVEWVQNIQDNSNVSCIIDERLGNSFTGEAMEGFIHLIMRCLEPSSERRPAMSHVVMELDRIHEKEISLTTIMGE

superfamily: SSF56112
IPR011009
49-348 Protein kinase-like (PK-like)
Protein kinase-like domain

VQVGRHAGVELSMRETRRFQMEELSLATKNFSDTNLIGEGKFGEVYMGFLQDGMLVAIKRRPGTPSQEFINEVHYLSAIQHRHIVTLLGYCQENNLQFLVYEYIHSGSVSSHLYGTGQHSRKKLEFKNRLSIALGAAKGLAHLHSLSPRLVHKDFKTANVLVDEDLLAKVADAGIRNFLGRVDIAGPSSQVTADEMFLAPEVREFRRFSEKSDIYSFGVFLLELVSGREAGELASSDSNQNLVEWVQNIQDNSNVSCIIDERLGNSFTGEAMEGFIHLIMRCLEPSSERRPAMSHVVMEL

Gene3D: G3DSA:3.30.200.20
62-138 no description

RETRRFQMEELSLATKNFSDTNLIGEGKFGEVYMGFLQDGMLVAIKRRPGTPSQEFINEVHYLSAIQHRHIVTLLGY

HMMSmart: SM00219
IPR020635
79-348 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDTNLIGEGKFGEVYMGFLQDGMLVAIKRRPGTPSQEFINEVHYLSAIQHRHIVTLLGYCQENNLQFLVYEYIHSGSVSSHLYGTGQHSRKKLEFKNRLSIALGAAKGLAHLHSLSPRLVHKDFKTANVLVDEDLLAKVADAGIRNFLGRVDIAGPSSQVTADEMFLAPEVREFRRFSEKSDIYSFGVFLLELVSGREAGELASSDSNQNLVEWVQNIQDNSNVSCIIDERLGNSFTGEAMEGFIHLIMRCLEPSSERRPAMSHVVMEL

ProfileScan: PS50011
IPR000719
79-355 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDTNLIGEGKFGEVYMGFLQDGMLVAIKRRPGTPSQEFINEVHYLSAIQHRHIVTLLGYCQENNLQFLVYEYIHSGSVSSHLYGTGQHSRKKLEFKNRLSIALGAAKGLAHLHSLSPRLVHKDFKTANVLVDEDLLAKVADAGIRNFLGRVDIAGPSSQVTADEMFLAPEVREFRRFSEKSDIYSFGVFLLELVSGREAGELASSDSNQNLVEWVQNIQDNSNVSCIIDERLGNSFTGEAMEGFIHLIMRCLEPSSERRPAMSHVVMELDRIHEKE

HMMSmart: SM00220
IPR002290
79-346 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSDTNLIGEGKFGEVYMGFLQDGMLVAIKRRPGTPSQEFINEVHYLSAIQHRHIVTLLGYCQENNLQFLVYEYIHSGSVSSHLYGTGQHSRKKLEFKNRLSIALGAAKGLAHLHSLSPRLVHKDFKTANVLVDEDLLAKVADAGIRNFLGRVDIAGPSSQVTADEMFLAPEVREFRRFSEKSDIYSFGVFLLELVSGREAGELASSDSNQNLVEWVQNIQDNSNVSCIIDERLGNSFTGEAMEGFIHLIMRCLEPSSERRPAMSHVVM

HMMPfam: PF07714
IPR001245
83-348 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NLIGEGKFGEVYMGFLQDGMLVAIKRRPGTPSQEFINEVHYLSAIQHRHIVTLLGYCQENNLQFLVYEYIHSGSVSSHLYGTGQHSRKKLEFKNRLSIALGAAKGLAHLHSLSPRLVHKDFKTANVLVDEDLLAKVADAGIRNFLGRVDIAGPSSQVTADEMFLAPEVREFRRFSEKSDIYSFGVFLLELVSGREAGELASSDSNQNLVEWVQNIQDNSNVSCIIDERLGNSFTGEAMEGFIHLIMRCLEPSSERRPAMSHVVMEL

PatternScan: PS00107
IPR017441
85-107 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGKFGEVYMGFLQDGMLVAIK

Gene3D: G3DSA:1.10.510.10
139-346 no description

CQENNLQFLVYEYIHSGSVSSHLYGTGQHSRKKLEFKNRLSIALGAAKGLAHLHSLSPRLVHKDFKTANVLVDEDLLAKVADAGIRNFLGRVDIAGPSSQVTADEMFLAPEVREFRRFSEKSDIYSFGVFLLELVSGREAGELASSDSNQNLVEWVQNIQDNSNVSCIIDERLGNSFTGEAMEGFIHLIMRCLEPSSERRPAMSHVVM

Seg: seg
181-195 seg

ALGAAKGLAHLHSLS

PatternScan: PS00108
IPR008271
198-210 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

LVHKDFKTANVLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox