PRGDB00172501 (ppa021401m)

From PRG Wiki
Jump to: navigation, search
ppa021401m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class N
Domain Type NBS
Gene Species Prunus persica

Comment?

ABC-2 type transporter family protein (best arabidopsis hit)

DNA Sequence

AAAGGTTCCATATTAAGTAGGGCCTCTAGCAATGGGTTGGGCTATTCTTTCTCACTTGCTGCAGAAGACAATACTTCAACAGCTAAGTCTACTTCAACTGAAGAAGGAGGTCCAGATGCAGACAAAGGGAGAAAATTACATGTGGACTCTACCTTACCAATTTATCTTAAGTTCGAAGATGTAAAGTATAAGGTAGCTGCAAAGAGTGTGAAAAGCTCAAATGCAGAGTACATTCTGCATGGAATCTCTGGTTCAGTGCTTCCAGGAGAGGTTCTTGCTCTAATGGGACCTTCAGGAGGCGGCAAAACAACTTTGCTCAATCTCCTCAGTGGAAGAGTCAAACTCAACAGCGGCACCATCACTTACAATGACCAACCATACGCCAAGTCCCTCAAACGGAGGATTGGATATGTAATGCAAGATGATCTTTTGTTCCCCCATCTTACAGTCAAAGAGACTCTAACTTATGCTGCCTTACTCCGTCTTCCCATTACCTTAACCAGAAACCAGAAAGAAGAAAGGGCCATGGATGTAATTAATGAGCTAGGCTTGGAAAGGTGCCAAGACACACTAATTGGTGGCACATTTGTTAGAGGAGTTTCTGGTGGTGAAAGAAAAAGAGTGTGCATTGGCAATGAAATCCTGCTCAACCCATCACTTCTGTTTTTAGATGAACCAACATCTGGTCTTGATTCGACAGCGGCACTTCGAACACTTCAGATGCTTCACATTATTGCAAAGGCTGGAAAAACAGTGGTGACTACAATACATCAACCGTCTAGCAGGATCTTTAACAAGTTTGATAAGCTTATTCTCTTGGGTAGAGGAAGCTCCTTATACTTCGGAAAAGCCTCTGAAGCAATGATGTACTTCTCCTCAATTGGCTGTGCACCCCTTATAGCTATGAACCCGGCAGAGTTTCTCATTGATCTGGCAAACGGTAACACAAATGAAAAATCACTTCCAACAGAATTGGAGGATAGAGGGCCTTCCGCAGTTGACATCCACGAGTTTCTAGTTGAAGCCAATCAAATCAGACTTGGAAAAATGGAGAAGGCAAAGCTCCTAAGCTCTGTGCTGACAGAGGGTGAGAGTAAGATGCAGAGGATGTCATATTCAAGGGAATCAAAAGCAACTTGGTGCGAACAGTTTTTGATTCTTTGCAGGAGGGGCCTTAAGGAGAGACGCCACGAATACTTAAGCTGTCTGCGTGTAGTTCAAGTTATCTCCACTGCTATAATCATAGGACTTCTATGGTGGCAATCTGATGCTTCATCCCCAAGGCGAGTTCAAGATCAGGCAGGGCTGTTGTTCTTCATTTCAGTATTTTGGGCTTTCTTTCCTATGTTTACTGCAGTTTTCACATTTCCACAAGAAAGAGCAATAGTAGCTAAAGAGAGATCAGTGGAGATGTACAAACTCAGTGCCTACTTTTTAGCTAGAAACATCAGTGATCTTCCTCTTGATCTCCTGCTCCCAATAGTGTTCCTCGTGATAGTGTACTTGATGGCAGGCTTGAAGCTCAGATTTTCTTCATTTTTTCAAACAATGCTTACAATTTTCCTCAGCATTGTGGCCTCTCAGGGTCTAGGATTGAGCATAGGTGCAGCATTTATCGACGTGAAAAAGGCAACAACGCTAGCTTCCATCATTGTTATGACATTCATGTTATCTGGTGGATTCTTTATCCAGAAAGTTCCATCAATGGTTTCGTGGATACGCTATATCTCCTTCAACTACCACACATACAGGCTACTCCTGAAAATTCAGTTTGCTTGTCAGTCTCCCTTCATCAATGAATTAAGACTTGATTCAGGTGTGATGGAAGTGGGAGCTATGATGGTGATGATCATTGGGTACCGATTACTGGCCTATTTATTACTCAGGACAATGAAGTTCAAGACAATGATGTAG


Protein sequences

Name Description Sequence
ppa021401m ABC-2 type transporter family protein (best arabidopsis hit)

KGSILSRASSNGLGYSFSLAAEDNTSTAKSTSTEEGGPDADKGRKLHVDSTLPIYLKFEDVKYKVAAKSVKSSNAEYILHGISGSVLPGEVLALMGPSGGGKTTLLNLLSGRVKLNSGTITYNDQPYAKSLKRRIGYVMQDDLLFPHLTVKETLTYAALLRLPITLTRNQKEERAMDVINELGLERCQDTLIGGTFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTAALRTLQMLHIIAKAGKTVVTTIHQPSSRIFNKFDKLILLGRGSSLYFGKASEAMMYFSSIGCAPLIAMNPAEFLIDLANGNTNEKSLPTELEDRGPSAVDIHEFLVEANQIRLGKMEKAKLLSSVLTEGESKMQRMSYSRESKATWCEQFLILCRRGLKERRHEYLSCLRVVQVISTAIIIGLLWWQSDASSPRRVQDQAGLLFFISVFWAFFPMFTAVFTFPQERAIVAKERSVEMYKLSAYFLARNISDLPLDLLLPIVFLVIVYLMAGLKLRFSSFFQTMLTIFLSIVASQGLGLSIGAAFIDVKKATTLASIIVMTFMLSGGFFIQKVPSMVSWIRYISFNYHTYRLLLKIQFACQSPFINELRLDSGVMEVGAMMVMIIGYRLLAYLLLRTMKFKTMM*

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
35-286 P-loop containing nucleoside triphosphate hydrolases

EGGPDADKGRKLHVDSTLPIYLKFEDVKYKVAAKSVKSSNAEYILHGISGSVLPGEVLALMGPSGGGKTTLLNLLSGRVKLNSGTITYNDQPYAKSLKRRIGYVMQDDLLFPHLTVKETLTYAALLRLPITLTRNQKEERAMDVINELGLERCQDTLIGGTFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTAALRTLQMLHIIAKAGKTVVTTIHQPSSRIFNKFDKLILLGRGSSLYFGKASE

HMMPanther: PTHR19241
49-632 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

DSTLPIYLKFEDVKYKVAAKSVKSSNAEYILHGISGSVLPGEVLALMGPSGGGKTTLLNLLSGRVKLNSGTITYNDQPYAKSLKRRIGYVMQDDLLFPHLTVKETLTYAALLRLPITLTRNQKEERAMDVINELGLERCQDTLIGGTFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTAALRTLQMLHIIAKAGKTVVTTIHQPSSRIFNKFDKLILLGRGSSLYFGKASEAMMYFSSIGCAPLIAMNPAEFLIDLANGNTNEKSLPTELEDRGPSAVDIHEFLVEANQIRLGKMEKAKLLSSVLTEGESKMQRMSYSRESKATWCEQFLILCRRGLKERRHEYLSCLRVVQVISTAIIIGLLWWQSDASSPRRVQDQAGLLFFISVFWAFFPMFTAVFTFPQERAIVAKERSVEMYKLSAYFLARNISDLPLDLLLPIVFLVIVYLMAGLKLRFSSFFQTMLTIFLSIVASQGLGLSIGAAFIDVKKATTLASIIVMTFMLSGGFFIQKVPSMVSWIRYISFNYHTYRLLLKIQFACQSPFINELRLDSGVMEVGAMMVMIIGYRLLAYLLLRTMK

HMMPanther: PTHR19241:SF23
49-632 ATP-BINDING CASSETTE TRANSPORTER,ATP-BINDING CASSETTE TRANSPORTER

DSTLPIYLKFEDVKYKVAAKSVKSSNAEYILHGISGSVLPGEVLALMGPSGGGKTTLLNLLSGRVKLNSGTITYNDQPYAKSLKRRIGYVMQDDLLFPHLTVKETLTYAALLRLPITLTRNQKEERAMDVINELGLERCQDTLIGGTFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTAALRTLQMLHIIAKAGKTVVTTIHQPSSRIFNKFDKLILLGRGSSLYFGKASEAMMYFSSIGCAPLIAMNPAEFLIDLANGNTNEKSLPTELEDRGPSAVDIHEFLVEANQIRLGKMEKAKLLSSVLTEGESKMQRMSYSRESKATWCEQFLILCRRGLKERRHEYLSCLRVVQVISTAIIIGLLWWQSDASSPRRVQDQAGLLFFISVFWAFFPMFTAVFTFPQERAIVAKERSVEMYKLSAYFLARNISDLPLDLLLPIVFLVIVYLMAGLKLRFSSFFQTMLTIFLSIVASQGLGLSIGAAFIDVKKATTLASIIVMTFMLSGGFFIQKVPSMVSWIRYISFNYHTYRLLLKIQFACQSPFINELRLDSGVMEVGAMMVMIIGYRLLAYLLLRTMK

ProfileScan: PS50893
IPR003439
56-300 ABC_TRANSPORTER_2
ABC transporter-like

LKFEDVKYKVAAKSVKSSNAEYILHGISGSVLPGEVLALMGPSGGGKTTLLNLLSGRVKLNSGTITYNDQPYAKSLKRRIGYVMQDDLLFPHLTVKETLTYAALLRLPITLTRNQKEERAMDVINELGLERCQDTLIGGTFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTAALRTLQMLHIIAKAGKTVVTTIHQPSSRIFNKFDKLILLGRGSSLYFGKASEAMMYFSSIGCAPLI

Gene3D: G3DSA:3.40.50.300
56-288 no description

LKFEDVKYKVAAKSVKSSNAEYILHGISGSVLPGEVLALMGPSGGGKTTLLNLLSGRVKLNSGTITYNDQPYAKSLKRRIGYVMQDDLLFPHLTVKETLTYAALLRLPITLTRNQKEERAMDVINELGLERCQDTLIGGTFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTAALRTLQMLHIIAKAGKTVVTTIHQPSSRIFNKFDKLILLGRGSSLYFGKASEAM

Seg: seg
61-75 seg

VKYKVAAKSVKSSNA

HMMSmart: SM00382
IPR003593
88-277 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGEVLALMGPSGGGKTTLLNLLSGRVKLNSGTITYNDQPYAKSLKRRIGYVMQDDLLFPHLTVKETLTYAALLRLPITLTRNQKEERAMDVINELGLERCQDTLIGGTFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTAALRTLQMLHIIAKAGKTVVTTIHQPSSRIFNKFDKLILLGRGS

HMMPfam: PF00005
IPR003439
103-228 ABC_tran
ABC transporter-like

TTLLNLLSGRVKLNSGTITYNDQPYAKSLKRRIGYVMQDDLLFPHLTVKETLTYAALLRLPITLTRNQKEERAMDVINELGLERCQDTLIGGTFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTS

PatternScan: PS00211
IPR017871
200-214 ABC_TRANSPORTER_1
ABC transporter, conserved site

VSGGERKRVCIGNEI

HMMPfam: PF01061
IPR013525
382-591 ABC2_membrane
ABC-2 type transporter

EQFLILCRRGLKERRHEYLSCLRVVQVISTAIIIGLLWWQSDASSPRRVQDQAGLLFFISVFWAFFPMFTAVFTFPQERAIVAKERSVEMYKLSAYFLARNISDLPLDLLLPIVFLVIVYLMAGLKLRFSSFFQTMLTIFLSIVASQGLGLSIGAAFIDVKKATTLASIIVMTFMLSGGFFIQKVPSMVSWIRYISFNYHTYRLLLKIQF

Seg: seg
485-502 seg

DLPLDLLLPIVFLVIVYL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox