PRGDB00172502 (ppa020601m)

From PRG Wiki
Jump to: navigation, search
ppa020601m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class TNL
Domain Type NBS, TIR, LRR
Gene Species Prunus persica

Comment?

Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

ATGCAAGAAGAGGTTCGTTCGTTGAGTAAAGTTTATCATTTTTCGGAATTTTGTACAGGACTAATATGGTTGTGTTGGACTAAGTTTCCTTTGGATTCAATACCCATTGATTTTTCTTTGGAAAGCGTTATTATTCTTGAAATGCAATACAGCGGTCTGAGACAAGTATTCAAGGGAACAAAAACCCTTGATCTCAGCCGTTCTCATTCCGTTACAGAAACCATTGACTTCTCATATTGCCCAAATCTAGAGAAATTGTTTCTAGTAGACTGCACAAGCCTGATTTATGTCCATGAATCCATTGGAAACCTAGAGAGACTTATTTACTTGAATATGAAAGATTGTAAAAAGATTAGGATGCTTCCCAAGAACATTTGTATGCTAAAATCACTTGAAACATTTATTATATGTGGTTGCTCAAATCTTAATGAGTTCCCAATTGAGATGCTAAGGAACATGGACTCGTTGAAAGTGCTGGAGACAGATGGAATTCCGATAAGTGAATTATGGCTAGAAAGAAGTTCGAGTATCTTGGGTTCTTTACCATGCTCTTTAGTAGAATTAAGTCTTTGGGGGTGCAATCTTTCGGATGATGCATTTCCTACGGATTTTAGTAATTTGTCCTCATTGCAAAGACTAAATCTAGGGAATAATCCAATTTGTAGTCTAGCGAGGGTCGATAAACTCTCTTTTTCCATGTGTACTAGTCTCAAATCGCTTCTGGGGTTACCAAAACTAAACGGCCTGGATATTCAAGGTTGCATTTCTTTGGAGAAAATGACACATCAATCCTTTCATTTTGAGTCAATGACACATCAATCCTTTTGTTTGGAGTCAATGACACTAGGTGGCAACTACAACCTAGTTGAGTGGCAGTACCAGTACAAGTTACAACCCATTGGTAGAGTTGATGTAGAAATGATCAACCTCTTGGGATTGTGCAGCTTGTTGGAATCAATGGCACCCATTCGGATGCACAGACCATCTCATATTTCAGCGAAGCATGATTGGAGGCCCGTCCAGGGACTGTATGAGGACGGTATATTCAGCACATTTTTTGGTGGGAATGAGGTTCCAGGCCAATTCAGCCATAAAAGTAGAGGGTCCTCAATATCTTTTGCCGTGCCTTTGCTTGATAATCACGGAATTAAAGGCTTGAACGTCTTTGCTGTCTATGAGTGTTTTGGCTCTGATTTTCCTTACTATGAGTGGCTCATGGGTGTGATGATTAGAGTCAGAAATAAGAGCAAGGGTCTAAAGTGGGACTATTCATCAACACACTACGGTATTCCAGATGAAGGAGAAGACATGATATGGTTAAGCCACTGGAAGTTTAAGGATGAGCACTTAGAAAGTGGCGATCAAGTGGTGGTTTCAGTAGATATAAAACATTGCTTTCAGGTAAAGGAGTTGGGGATCCAGTTTGTGCAGGTGGAACAAGAGAGTCATAATATGATGAGTACCACCGATATTTCAGACTAT


Protein sequences

Name Description Sequence
ppa020601m Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

MQEEVRSLSKVYHFSEFCTGLIWLCWTKFPLDSIPIDFSLESVIILEMQYSGLRQVFKGTKTLDLSRSHSVTETIDFSYCPNLEKLFLVDCTSLIYVHESIGNLERLIYLNMKDCKKIRMLPKNICMLKSLETFIICGCSNLNEFPIEMLRNMDSLKVLETDGIPISELWLERSSSILGSLPCSLVELSLWGCNLSDDAFPTDFSNLSSLQRLNLGNNPICSLARVDKLSFSMCTSLKSLLGLPKLNGLDIQGCISLEKMTHQSFHFESMTHQSFCLESMTLGGNYNLVEWQYQYKLQPIGRVDVEMINLLGLCSLLESMAPIRMHRPSHISAKHDWRPVQGLYEDGIFSTFFGGNEVPGQFSHKSRGSSISFAVPLLDNHGIKGLNVFAVYECFGSDFPYYEWLMGVMIRVRNKSKGLKWDYSSTHYGIPDEGEDMIWLSHWKFKDEHLESGDQVVVSVDIKHCFQVKELGIQFVQVEQESHNMMSTTDISDY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
21-259 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LIWLCWTKFPLDSIPIDFSLESVIILEMQYSGLRQVFKGTKTLDLSRSHSVTETIDFSYCPNLEKLFLVDCTSLIYVHESIGNLERLIYLNMKDCKKIRMLPKNICMLKSLETFIICGCSNLNEFPIEMLRNMDSLKVLETDGIPISELWLERSSSILGSLPCSLVELSLWGCNLSDDAFPTDFSNLSSLQRLNLGNNPICSLARVDKLSFSMCTSLKSLLGLPKLNGLDIQGCISLEK

HMMPanther: PTHR11017:SF130
21-259 DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

LIWLCWTKFPLDSIPIDFSLESVIILEMQYSGLRQVFKGTKTLDLSRSHSVTETIDFSYCPNLEKLFLVDCTSLIYVHESIGNLERLIYLNMKDCKKIRMLPKNICMLKSLETFIICGCSNLNEFPIEMLRNMDSLKVLETDGIPISELWLERSSSILGSLPCSLVELSLWGCNLSDDAFPTDFSNLSSLQRLNLGNNPICSLARVDKLSFSMCTSLKSLLGLPKLNGLDIQGCISLEK

superfamily: SSF52058
39-327 L domain-like,LRR

SLESVIILEMQYSGLRQVFKGTKTLDLSRSHSVTETIDFSYCPNLEKLFLVDCTSLIYVHESIGNLERLIYLNMKDCKKIRMLPKNICMLKSLETFIICGCSNLNEFPIEMLRNMDSLKVLETDGIPISELWLERSSSILGSLPCSLVELSLWGCNLSDDAFPTDFSNLSSLQRLNLGNNPICSLARVDKLSFSMCTSLKSLLGLPKLNGLDIQGCISLEKMTHQSFHFESMTHQSFCLESMTLGGNYNLVEWQYQYKLQPIGRVDVEMINLLGLCSLLESMAPIRMHR

Gene3D: G3DSA:3.80.10.10
57-168 no description

FKGTKTLDLSRSHSVTETIDFSYCPNLEKLFLVDCTSLIYVHESIGNLERLIYLNMKDCKKIRMLPKNICMLKSLETFIICGCSNLNEFPIEMLRNMDSLKVLETDGIPISE

Gene3D: G3DSA:3.80.10.10
176-290 no description

SILGSLPCSLVELSLWGCNLSDDAFPTDFSNLSSLQRLNLGNNPICSLARVDKLSFSMCTSLKSLLGLPKLNGLDIQGCISLEKMTHQSFHFESMTHQSFCLESMTLGGNYNLVE

HMMPfam: PF12799
184-224 LRR_4,Leucine Rich repeats (2 copies)

SLVELSLWGCNLSDDAFPTDFSNLSSLQRLNLGNNPICSLA

ProfileScan: PS51450
IPR001611
209-230 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQRLNLGNNPICSLARVDKLS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox