PRGDB00172505 (ppa000249m)

From PRG Wiki
Jump to: navigation, search
ppa000249m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class N
Domain Type NBS
Gene Species Prunus persica

Comment?

pleiotropic drug resistance 5 (best arabidopsis hit)

DNA Sequence

ATGGCTCAGATGGTCGGTAGAGATGAGATAGAGTCACTAAGAATTGAGTTGGAAGAGTTTGGAAGAAGCCTTAGGTTATCATTTCAGAGTCGCTCCTCCAGTTTCCGAGGCAATTCAGTATTGAGTTCTGCCAAAGATGACTCTGATGCTCAATATGCTGAGCACTGGGCAGCTATTGAGAGATTGCCAACATTTGAACGATTGAAATCATCTTTGTTTGATCAGGGTGAGGATGAAAATGAGGCTGATGGTGAAGGAAAGCGAGTGGTTGATGTTACCAAGCTTCGAGCTCTGGAACGACATCTGTTCATAGAGAAGCTCATCAAACACATTGAGAATGACAACCTTCGTCTCTTGCGTAAAATTAGAAATAGGATTGACAGGGTTGGCGTAGAATTGCCCACTGTCGAGGTGAGGTATAAGGATCTGTTTGTGGAAGCAGTGTGTGAGGTGGTTCATGGAAAACCCCTCCCAACTCTATGGAATTCTGTCAAAAGCATGCTTTCTGTTTTTGCCAAGTTTCCTGGTTTGAAGTCTCGTGAGGCCACGATAAGCATTATTAAAGACTTTAGGGGTACAATAAAGCCTGGAAGGTTAACTTTACTGCTTGGCCCCCCAGGATGTGGGAAGACCACCTTTTTAAAGGCGCTATCAGGGAATCTGGACAAATCCCTCAAGTGGTCAGGCGAAGTTACCTACAACGGACACAAACTAGGGGAGTTTGTCCCCCAGAAAACTTCAGCTTATATAAGCCAACTCGACGTGCACATTCCTGAGATGACTGTGAGGGAAACACTTGATTTTTCAGCCCGCTGTCAGGGTATTGGAAGCCGAGCTGATATTATGCTGGAAGTGAGTAAAAGGGAGAAGGAGGCAGGAATTATTCCAGATCCAGATGTAGATACCTACATGAAGGCAATTTCTGTTCAAGGACTGAAAAGAACCCTTCAGACAGACTACATATTGAAGATCCTTGGACTTGATATATGTGCTGACACTCTGGTTGGAGATGCCATGAGAAGAGGTATCTCTGGTGGACAAAAGAAGAGACTGACAACAGCGGAGATGATCATTGGTCCCACGAAAGCTTTGTTCATGGATGAAATAACAAATGGCTTGGACAGTTCCACTGCATTCCAGATTGTTGCTTGTCTTCAGCAGCTGGTGCATATAACAGATGCTACTTTACTAGTTTCACTTCTTCAGCCTGCACCGGAGACCTTTGATCTCTTTGATGACCTTATATTAATGTCAGAAGGGAAGATTGTTTATCATGGTCCGCGGGATCATGTCTTGGAATTTTTTGAGGATTGTGGGTTTAAGTGTCCTGAGAGGAAAGGGGTTGCTGATTTCATTCAACAGGTAATCTCTAAAAAGGATCAATCACACTATTGGTACCATGCGGAACCTCACAACTATGTATCCATTGATATGTTCTCAAAAAAATTCAAGACTTCTTCTTTTGGGAAGAAGCTAGATGAAGATCTCATACAGACAGACGATGAGCCCCAAAACCATAAGAATTCTCTTTCCTTTAGTGTGTATTCTCTTTCTAAATGGGAACTCTTTAGAGCTTGTGCATCGAGAGAACTTCTTCTAATGAGGAGGAATTCTTTTATCTATGTGTTCAAGACAGTTCAGCTTATCACCATTGCATTTATTACGATGACTGTATTTTTGAGAACTCGAATGGATGTTGATGTTCTGCATGGTAACTACTACATGGGTGCCTTGTTCTTTGCTCTCATCATACTTCTCGTCGATGGAATTCCTGAGATGTCAATGACGCTTCAAAGACTGGAAGTTTTCTACAAACAGAGAGACCTGTGTTTCTACCCAGCTTGGGCTTATGCAGTTCCTGCAACACTATTAAAAGTTCCTGTTTCATTTGTGGAAGCCCTGGTTTGGACTTCTCTTACTTATTATGTCATTGGATACAGTCCTGAGGCCCAGAGGTTCTTCTGCCAGTTCTTGCTACTTTTTGCCGTTCACTTAACATCACTATCCATGTTTCGCTTCCTGGCCTCATTCTTTCAGACTATGGTTGCCACTATGACAGCTGGTAGCTTTGCAATATTGTTTCTCTTGCTATTTAGTGGATTTGTTATCCAAAAACCTTCCATGCCTGCTTGGTTAGAGTGGGGTTTCTGGGTTTCCCCCCTGACATATGGAGAGATAGGCCTCTCTGTAAATGAGTTTCTTTCTCCTCGATGGCAAAAGATGCTATCCGCAAACACTACTATTGGGAGAGAAGTACTTGGAAGCCGTGGGCTAAACTTTGATGGATATCTCTACTGGATATCACTTGGTGCCTTATTTGGGTTTTCAATAGTTTTCAGCATCGGATATACCTTGTCATTAAGTTTCTTGAAGTGCAGGATGGTCTTACCTTTTACTCCCTTGACACTGGTGTTCCAAGATGTGCAATACTATGTTATTCCTTCGGAAACCAGGGAACGTGGATTTAATCAGAAAAAACTCCAGCTTCTGAGTGATGTTACAGGAGCATTTAGTCCTGGTGTTCTTACAGCATTGATGGGTGTCAGTGGAGCTGGGAAAACAACTCTTCTTGATGTTCTGGCAGGCAGAAAGACTAGTGGATACACTGAAGGAGACATAAAGATTGGTGGGTATCCCAAGGTTCAAGAAACATTTGCTAGGATATTGGGTTACTGTGAGCAGACCGACGTACATTCTCCACAAATCACCGTAGAAGAATCTCTGATCTTTTCTGCTTGGCTGCGTCTGGCATCTCAGATTGACTCAAAAACAAAAGCTGAGTTTGTGAATGAAGTCCTTGAGACCATTGAGCTTGATGGGATAAAAGATGCCTTGGTTGGCATACCTGGTGTTAGTGGTCTATCAACTGAGCAGCGTAAGCGGCTTACAATTGCTGTGGAGCTTGTTTCAAACCCCTCCATAATCTTCATGGATGAACCTACAACTGGTTTGGATGCAAGAGCTGCTGCAATAGTCATGCGAGCAGTGAAGAATGTAGCTAATACAGGAAGAACAATTGTATGCACCATTCACCAACCAAATATCGATATATTTGAGGCATTTGATGAGCTAATTCTTTTGAAAACTGGAGGACGTATAATCTACTCTGGACCATTGGGCCAGCACTCGAGTAGGGTTATAGAATATTTTCAGAGTATTCCTGGTGTTCATAAAATTAGAGATAACTACAATCCAGCAACGTGGATGCTTGAGGTCACTTCTACATCAGCTGAAGCTGAACTTGGTGTTGATTTTGCCCAAATATACAGAAAATCTTCTTTGCATGAGAACAATATAGAGCTTGTAAGACAGTTGAGCACCCCACCTCCTGGTTCAAGAGATCTGTATTTTTCTACCCGCTTTTCTCAAAATGGATGGATGCAATTCAAATCTTGTCTATGGAAGCAGAACTTGTCTTATTGGAGGAGTCCTCCGTACAACTTGATGCGCATCATGCATACGGTTGTATCATCCATAATTTTTGGGGCATTATTTTGGAACCAAGGACAGCATATAACCAACCAGCAAAACTTATTTAACATACTTGGTTCAATGTACGCTGGCGTCCTCTTCTTGGGCATAAATAACTGCTCAACAGTTCTGCAATATGTTGCAACAGAGAGAACTGTTATGTATAGGGAGAAATTTGCAGGGATGTACTCTCCATGGGCTTTTTCACTCGCACAGGTGGCAGTAGAAGTTCCCTACCTATTTATCCAGGCAGTCATATTTCTGATCATCACATATCCCATGATTGGATATTATGGATCAGCATATAAGGTTTTCTGGTACTTCTATGCTGTGTTTTGTTCATTGATGTACCACAACTACATGGGATTGATGCTCGTGTCGTTGACACCAAACTTCATGATAGCAGCAATTCTATCGTCGGTGTTCTACACGTTATACAATCTGTTTGCCGGTTTTCTGATTCCTAGACCGCAAATTCCTAAATGGTGGATTTGGTTGTATTACCTGACTCCAACATCTTGGTCACTACACGGTTTGCTTACTTCACAATATGGAGACATAAACAAGGAGGTTATAGTATTTGGGGAAAACAAAACAGTGTCTGACTTCTTAAAGGATTACTTTGGGTTTCACCATGATCAGTTGGCTCTGGTTGCAGTGGTTCTCATTGCTTTTCCCATTGCTTTCGCATCCATTTTTGCGTTCTGCATAGGGCGGTTGAACTTCCAGAGGAGGTGA


Protein sequences

Name Description Sequence
ppa000249m pleiotropic drug resistance 5 (best arabidopsis hit)

MAQMVGRDEIESLRIELEEFGRSLRLSFQSRSSSFRGNSVLSSAKDDSDAQYAEHWAAIERLPTFERLKSSLFDQGEDENEADGEGKRVVDVTKLRALERHLFIEKLIKHIENDNLRLLRKIRNRIDRVGVELPTVEVRYKDLFVEAVCEVVHGKPLPTLWNSVKSMLSVFAKFPGLKSREATISIIKDFRGTIKPGRLTLLLGPPGCGKTTFLKALSGNLDKSLKWSGEVTYNGHKLGEFVPQKTSAYISQLDVHIPEMTVRETLDFSARCQGIGSRADIMLEVSKREKEAGIIPDPDVDTYMKAISVQGLKRTLQTDYILKILGLDICADTLVGDAMRRGISGGQKKRLTTAEMIIGPTKALFMDEITNGLDSSTAFQIVACLQQLVHITDATLLVSLLQPAPETFDLFDDLILMSEGKIVYHGPRDHVLEFFEDCGFKCPERKGVADFIQQVISKKDQSHYWYHAEPHNYVSIDMFSKKFKTSSFGKKLDEDLIQTDDEPQNHKNSLSFSVYSLSKWELFRACASRELLLMRRNSFIYVFKTVQLITIAFITMTVFLRTRMDVDVLHGNYYMGALFFALIILLVDGIPEMSMTLQRLEVFYKQRDLCFYPAWAYAVPATLLKVPVSFVEALVWTSLTYYVIGYSPEAQRFFCQFLLLFAVHLTSLSMFRFLASFFQTMVATMTAGSFAILFLLLFSGFVIQKPSMPAWLEWGFWVSPLTYGEIGLSVNEFLSPRWQKMLSANTTIGREVLGSRGLNFDGYLYWISLGALFGFSIVFSIGYTLSLSFLKCRMVLPFTPLTLVFQDVQYYVIPSETRERGFNQKKLQLLSDVTGAFSPGVLTALMGVSGAGKTTLLDVLAGRKTSGYTEGDIKIGGYPKVQETFARILGYCEQTDVHSPQITVEESLIFSAWLRLASQIDSKTKAEFVNEVLETIELDGIKDALVGIPGVSGLSTEQRKRLTIAVELVSNPSIIFMDEPTTGLDARAAAIVMRAVKNVANTGRTIVCTIHQPNIDIFEAFDELILLKTGGRIIYSGPLGQHSSRVIEYFQSIPGVHKIRDNYNPATWMLEVTSTSAEAELGVDFAQIYRKSSLHENNIELVRQLSTPPPGSRDLYFSTRFSQNGWMQFKSCLWKQNLSYWRSPPYNLMRIMHTVVSSIIFGALFWNQGQHITNQQNLFNILGSMYAGVLFLGINNCSTVLQYVATERTVMYREKFAGMYSPWAFSLAQVAVEVPYLFIQAVIFLIITYPMIGYYGSAYKVFWYFYAVFCSLMYHNYMGLMLVSLTPNFMIAAILSSVFYTLYNLFAGFLIPRPQIPKWWIWLYYLTPTSWSLHGLLTSQYGDINKEVIVFGENKTVSDFLKDYFGFHHDQLALVAVVLIAFPIAFASIFAFCIGRLNFQRR*

Domains

Domain Start-End Description Sequence

Seg: seg
20-43 seg

FGRSLRLSFQSRSSSFRGNSVLSS

Seg: seg
113-128 seg

NDNLRLLRKIRNRIDR

superfamily: SSF52540
168-448 P-loop containing nucleoside triphosphate hydrolases

LSVFAKFPGLKSREATISIIKDFRGTIKPGRLTLLLGPPGCGKTTFLKALSGNLDKSLKWSGEVTYNGHKLGEFVPQKTSAYISQLDVHIPEMTVRETLDFSARCQGIGSRADIMLEVSKREKEAGIIPDPDVDTYMKAISVQGLKRTLQTDYILKILGLDICADTLVGDAMRRGISGGQKKRLTTAEMIIGPTKALFMDEITNGLDSSTAFQIVACLQQLVHITDATLLVSLLQPAPETFDLFDDLILMSEGKIVYHGPRDHVLEFFEDCGFKCPERKGV

ProfileScan: PS50893
IPR003439
172-444 ABC_TRANSPORTER_2
ABC transporter-like

AKFPGLKSREATISIIKDFRGTIKPGRLTLLLGPPGCGKTTFLKALSGNLDKSLKWSGEVTYNGHKLGEFVPQKTSAYISQLDVHIPEMTVRETLDFSARCQGIGSRADIMLEVSKREKEAGIIPDPDVDTYMKAISVQGLKRTLQTDYILKILGLDICADTLVGDAMRRGISGGQKKRLTTAEMIIGPTKALFMDEITNGLDSSTAFQIVACLQQLVHITDATLLVSLLQPAPETFDLFDDLILMSEGKIVYHGPRDHVLEFFEDCGFKCPE

Gene3D: G3DSA:3.40.50.300
184-433 no description

ISIIKDFRGTIKPGRLTLLLGPPGCGKTTFLKALSGNLDKSLKWSGEVTYNGHKLGEFVPQKTSAYISQLDVHIPEMTVRETLDFSARCQGIGSRADIMLEVSKREKEAGIIPDPDVDTYMKAISVQGLKRTLQTDYILKILGLDICADTLVGDAMRRGISGGQKKRLTTAEMIIGPTKALFMDEITNGLDSSTAFQIVACLQQLVHITDATLLVSLLQPAPETFDLFDDLILMSEGKIVYHGPRDHVLE

HMMSmart: SM00382
IPR003593
196-421 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGRLTLLLGPPGCGKTTFLKALSGNLDKSLKWSGEVTYNGHKLGEFVPQKTSAYISQLDVHIPEMTVRETLDFSARCQGIGSRADIMLEVSKREKEAGIIPDPDVDTYMKAISVQGLKRTLQTDYILKILGLDICADTLVGDAMRRGISGGQKKRLTTAEMIIGPTKALFMDEITNGLDSSTAFQIVACLQQLVHITDATLLVSLLQPAPETFDLFDDLILMSEGK

Seg: seg
196-212 seg

PGRLTLLLGPPGCGKTT

HMMPfam: PF00005
IPR003439
211-371 ABC_tran
ABC transporter-like

TTFLKALSGNLDKSLKWSGEVTYNGHKLGEFVPQKTSAYISQLDVHIPEMTVRETLDFSARCQGIGSRADIMLEVSKREKEAGIIPDPDVDTYMKAISVQGLKRTLQTDYILKILGLDICADTLVGDAMRRGISGGQKKRLTTAEMIIGPTKALFMDEITN

HMMPanther: PTHR19241:SF10
372-1402 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

GLDSSTAFQIVACLQQLVHITDATLLVSLLQPAPETFDLFDDLILMSEGKIVYHGPRDHVLEFFEDCGFKCPERKGVADFIQQVISKKDQSHYWYHAEPHNYVSIDMFSKKFKTSSFGKKLDEDLIQTDDEPQNHKNSLSFSVYSLSKWELFRACASRELLLMRRNSFIYVFKTVQLITIAFITMTVFLRTRMDVDVLHGNYYMGALFFALIILLVDGIPEMSMTLQRLEVFYKQRDLCFYPAWAYAVPATLLKVPVSFVEALVWTSLTYYVIGYSPEAQRFFCQFLLLFAVHLTSLSMFRFLASFFQTMVATMTAGSFAILFLLLFSGFVIQKPSMPAWLEWGFWVSPLTYGEIGLSVNEFLSPRWQKMLSANTTIGREVLGSRGLNFDGYLYWISLGALFGFSIVFSIGYTLSLSFLKCRMVLPFTPLTLVFQDVQYYVIPSETRERGFNQKKLQLLSDVTGAFSPGVLTALMGVSGAGKTTLLDVLAGRKTSGYTEGDIKIGGYPKVQETFARILGYCEQTDVHSPQITVEESLIFSAWLRLASQIDSKTKAEFVNEVLETIELDGIKDALVGIPGVSGLSTEQRKRLTIAVELVSNPSIIFMDEPTTGLDARAAAIVMRAVKNVANTGRTIVCTIHQPNIDIFEAFDELILLKTGGRIIYSGPLGQHSSRVIEYFQSIPGVHKIRDNYNPATWMLEVTSTSAEAELGVDFAQIYRKSSLHENNIELVRQLSTPPPGSRDLYFSTRFSQNGWMQFKSCLWKQNLSYWRSPPYNLMRIMHTVVSSIIFGALFWNQGQHITNQQNLFNILGSMYAGVLFLGINNCSTVLQYVATERTVMYREKFAGMYSPWAFSLAQVAVEVPYLFIQAVIFLIITYPMIGYYGSAYKVFWYFYAVFCSLMYHNYMGLMLVSLTPNFMIAAILSSVFYTLYNLFAGFLIPRPQIPKWWIWLYYLTPTSWSLHGLLTSQYGDINKEVIVFGENKTVSDFLKDYFGFHHDQLALVAVVLIAFPIAFASIFAFCIGRLNFQRR

HMMPanther: PTHR19241
372-1402 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

GLDSSTAFQIVACLQQLVHITDATLLVSLLQPAPETFDLFDDLILMSEGKIVYHGPRDHVLEFFEDCGFKCPERKGVADFIQQVISKKDQSHYWYHAEPHNYVSIDMFSKKFKTSSFGKKLDEDLIQTDDEPQNHKNSLSFSVYSLSKWELFRACASRELLLMRRNSFIYVFKTVQLITIAFITMTVFLRTRMDVDVLHGNYYMGALFFALIILLVDGIPEMSMTLQRLEVFYKQRDLCFYPAWAYAVPATLLKVPVSFVEALVWTSLTYYVIGYSPEAQRFFCQFLLLFAVHLTSLSMFRFLASFFQTMVATMTAGSFAILFLLLFSGFVIQKPSMPAWLEWGFWVSPLTYGEIGLSVNEFLSPRWQKMLSANTTIGREVLGSRGLNFDGYLYWISLGALFGFSIVFSIGYTLSLSFLKCRMVLPFTPLTLVFQDVQYYVIPSETRERGFNQKKLQLLSDVTGAFSPGVLTALMGVSGAGKTTLLDVLAGRKTSGYTEGDIKIGGYPKVQETFARILGYCEQTDVHSPQITVEESLIFSAWLRLASQIDSKTKAEFVNEVLETIELDGIKDALVGIPGVSGLSTEQRKRLTIAVELVSNPSIIFMDEPTTGLDARAAAIVMRAVKNVANTGRTIVCTIHQPNIDIFEAFDELILLKTGGRIIYSGPLGQHSSRVIEYFQSIPGVHKIRDNYNPATWMLEVTSTSAEAELGVDFAQIYRKSSLHENNIELVRQLSTPPPGSRDLYFSTRFSQNGWMQFKSCLWKQNLSYWRSPPYNLMRIMHTVVSSIIFGALFWNQGQHITNQQNLFNILGSMYAGVLFLGINNCSTVLQYVATERTVMYREKFAGMYSPWAFSLAQVAVEVPYLFIQAVIFLIITYPMIGYYGSAYKVFWYFYAVFCSLMYHNYMGLMLVSLTPNFMIAAILSSVFYTLYNLFAGFLIPRPQIPKWWIWLYYLTPTSWSLHGLLTSQYGDINKEVIVFGENKTVSDFLKDYFGFHHDQLALVAVVLIAFPIAFASIFAFCIGRLNFQRR

Seg: seg
479-491 seg

FSKKFKTSSFGKK

HMMPfam: PF01061
IPR013525
522-733 ABC2_membrane
ABC-2 type transporter

LFRACASRELLLMRRNSFIYVFKTVQLITIAFITMTVFLRTRMDVDVLHGNYYMGALFFALIILLVDGIPEMSMTLQRLEVFYKQRDLCFYPAWAYAVPATLLKVPVSFVEALVWTSLTYYVIGYSPEAQRFFCQFLLLFAVHLTSLSMFRFLASFFQTMVATMTAGSFAILFLLLFSGFVIQKPSMPAWLEWGFWVSPLTYGEIGLSVNEF

HMMPfam: PF08370
IPR013581
738-791 PDR_assoc
Plant PDR ABC transporter associated

WQKMLSANTTIGREVLGSRGLNFDGYLYWISLGALFGFSIVFSIGYTLSLSFLK

ProfileScan: PS50893
IPR003439
803-1055 ABC_TRANSPORTER_2
ABC transporter-like

LVFQDVQYYVIPSETRERGFNQKKLQLLSDVTGAFSPGVLTALMGVSGAGKTTLLDVLAGRKTSGYTEGDIKIGGYPKVQETFARILGYCEQTDVHSPQITVEESLIFSAWLRLASQIDSKTKAEFVNEVLETIELDGIKDALVGIPGVSGLSTEQRKRLTIAVELVSNPSIIFMDEPTTGLDARAAAIVMRAVKNVANTGRTIVCTIHQPNIDIFEAFDELILLKTGGRIIYSGPLGQHSSRVIEYFQSIPG

superfamily: SSF52540
811-1041 P-loop containing nucleoside triphosphate hydrolases

YVIPSETRERGFNQKKLQLLSDVTGAFSPGVLTALMGVSGAGKTTLLDVLAGRKTSGYTEGDIKIGGYPKVQETFARILGYCEQTDVHSPQITVEESLIFSAWLRLASQIDSKTKAEFVNEVLETIELDGIKDALVGIPGVSGLSTEQRKRLTIAVELVSNPSIIFMDEPTTGLDARAAAIVMRAVKNVANTGRTIVCTIHQPNIDIFEAFDELILLKTGGRIIYSGPLGQ

Gene3D: G3DSA:3.40.50.300
825-1041 no description

KKLQLLSDVTGAFSPGVLTALMGVSGAGKTTLLDVLAGRKTSGYTEGDIKIGGYPKVQETFARILGYCEQTDVHSPQITVEESLIFSAWLRLASQIDSKTKAEFVNEVLETIELDGIKDALVGIPGVSGLSTEQRKRLTIAVELVSNPSIIFMDEPTTGLDARAAAIVMRAVKNVANTGRTIVCTIHQPNIDIFEAFDELILLKTGGRIIYSGPLGQ

HMMSmart: SM00382
IPR003593
839-1031 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGVLTALMGVSGAGKTTLLDVLAGRKTSGYTEGDIKIGGYPKVQETFARILGYCEQTDVHSPQITVEESLIFSAWLRLASQIDSKTKAEFVNEVLETIELDGIKDALVGIPGVSGLSTEQRKRLTIAVELVSNPSIIFMDEPTTGLDARAAAIVMRAVKNVANTGRTIVCTIHQPNIDIFEAFDELILLKTGG

HMMPfam: PF00005
IPR003439
854-982 ABC_tran
ABC transporter-like

TTLLDVLAGRKTSGYTEGDIKIGGYPKVQETFARILGYCEQTDVHSPQITVEESLIFSAWLRLASQIDSKTKAEFVNEVLETIELDGIKDALVGIPGVSGLSTEQRKRLTIAVELVSNPSIIFMDEPTT

HMMPfam: PF01061
IPR013525
1127-1341 ABC2_membrane
ABC-2 type transporter

MQFKSCLWKQNLSYWRSPPYNLMRIMHTVVSSIIFGALFWNQGQHITNQQNLFNILGSMYAGVLFLGINNCSTVLQYVATERTVMYREKFAGMYSPWAFSLAQVAVEVPYLFIQAVIFLIITYPMIGYYGSAYKVFWYFYAVFCSLMYHNYMGLMLVSLTPNFMIAAILSSVFYTLYNLFAGFLIPRPQIPKWWIWLYYLTPTSWSLHGLLTSQY

Seg: seg
1380-1394 seg

IAFPIAFASIFAFCI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox