PRGDB00172508 (ppa017752m)

From PRG Wiki
Jump to: navigation, search
ppa017752m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Prunus persica

Comment?

Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

DNA Sequence

AATGATGTCTTTATCAGTTATAGAGCTGCAGATACACGCTACAATTTTACAGACCACTTGTACAGCAATTTGCAACAGAAGGGAATTAAAACCTTCATGGATACTGACTATAAGAGAGGGGAAGAAATGTCACCAGCACTTTGGAACGAAATTGAAGGGTCGAAGATTTCTATCATCGTATTCTCCGAAAACTTTGGATCCTCGTCCTGGTGCTTGGATGAACTCGTCAAGATCCTTGATTGTAAAAGTTCAAAACAACAGATGGTTATGCCAATTTTTTACAAAGTGAAACCCTCGCATGTGAGAAAGCAATTGGGCACTTTTGGTGAAGCATTTGTCGACCATGAACGCATATTCATTAATGACATGGAGAAGGTGATGAGATGGAGGGCAGTTCTTACGGAAGCAGCAAATTTGCACGGGTGGACTTTGAAGGATGGGAGCGAGTCCAAATTTATCAATGACATCGTTGAAGAGATTTCATTGCAAGTATTAAATCGTACATATTTGCATGTGGCAAAGTACCCAGTTGGTATAGAGTCTCGTTTGCAAGATATGGGTGAGCTTTTAGGTGCTGGGGTAAATGATGTTCGCATGGTAGGTATATGGGGGATTAGGGGAATAGGTAAGACAACAATTGCCAAAGCAGTTTATAACTCAATTGTCCATCAGTTTGAAGGTAGTTGTTTTCTGGAAAATGTTAGAGAAAACTCAGCGGCACCTAGAGGCCTGCTCCAACTACAGAAGACTCTTCTTTATGAGATTCTAGGGGGAAAAGAATTGGAGTTGACAAGCGTTGATAAAGGTATCAATGTAATAAAGCAAAGGTTGAGTCATAAAAGGGTTCTCTTGATGCTTGATGATGTGGATCAATTGGACCAATTAAACAAATTAGCTGGAAGGTCTGATTGGCTTGGTTTGGGTAGTAGAATTATCATAACAACAAGACATAAGCATTTGCTAACGTCTCATCAAGTTGACTTAGTGTATGAGGTCAAGGAACTAGATACTTATGAAGCTTCTGAACTCTTCAGCTATAACGCCTTCCCGGAAAAAGGACTTCCAGATGATTATAAGAACCTTGCAGTAAGTCTAGTAGATTATGCTAAGGGGATCCCATTAGCTCTCACGGTTACTGGTTCGCTTCTATGTGGTAGAAGTGTAGATGAGTGGCGAGCTGCATTGGATTGTTACAGAAGAGCTCCTTCCCTGGATACTGATGAAATCCTCAAAATAACCAAAAATGCTCTAGAACATCCGGAAATATCCATGGAAACTGCCCTCGTGAGGATTGATCCGAATGAAGAAGAACATGTTCAAATGCATGACTTGCAAGAAGAAATGCATATAGAAACTGCTCGACAGGATGTTCGTGAGGATGTTTACATTGTATTTTCAGCGGAGTGGATGTTTTTAATCGTTAGCCTGATGCTAGAGATCTTTTCAGCTATATGTGATCAACTTTCCTCCCCAAGAAAGCCCCTCTATGCACTCTTTGGTATGGGGCTGGCTATTATGGCTCTAGCCACTTGCATTTGGGAATTCATTCACAAAGGCAGAAGAGGAAATGTTCAATTTGGCAAGTGCGGAATATTGCTGTGGTGGTTTTATTGTCCATGTTCAGGCACCCTTTTTGGTACTTTCCCTGAGATTTGTGGATTAATTTATGCAATCACTCAGTGGGCGTACTCCATGGTTCAGTTTGTGTGCGTGCTTCGGCATAAGGACAATCCTTTCAAAGTAAACATTTTGCCTGTCCTTTTTCTTCTGTGTTTGGTTGTTTCAAAATTAATTCGGAATGCAAGGGGCAGAACAAGAGAGGAGACCAGTGAGAAGGAATTGGAATCCATTGCTGTTGGCTCTTGA


Protein sequences

Name Description Sequence
ppa017752m Disease resistance protein (TIR-NBS-LRR class) family (best arabidopsis hit)

NDVFISYRAADTRYNFTDHLYSNLQQKGIKTFMDTDYKRGEEMSPALWNEIEGSKISIIVFSENFGSSSWCLDELVKILDCKSSKQQMVMPIFYKVKPSHVRKQLGTFGEAFVDHERIFINDMEKVMRWRAVLTEAANLHGWTLKDGSESKFINDIVEEISLQVLNRTYLHVAKYPVGIESRLQDMGELLGAGVNDVRMVGIWGIRGIGKTTIAKAVYNSIVHQFEGSCFLENVRENSAAPRGLLQLQKTLLYEILGGKELELTSVDKGINVIKQRLSHKRVLLMLDDVDQLDQLNKLAGRSDWLGLGSRIIITTRHKHLLTSHQVDLVYEVKELDTYEASELFSYNAFPEKGLPDDYKNLAVSLVDYAKGIPLALTVTGSLLCGRSVDEWRAALDCYRRAPSLDTDEILKITKNALEHPEISMETALVRIDPNEEEHVQMHDLQEEMHIETARQDVREDVYIVFSAEWMFLIVSLMLEIFSAICDQLSSPRKPLYALFGMGLAIMALATCIWEFIHKGRRGNVQFGKCGILLWWFYCPCSGTLFGTFPEICGLIYAITQWAYSMVQFVCVLRHKDNPFKVNILPVLFLLCLVVSKLIRNARGRTREETSEKELESIAVGS*

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
1-139 TIR
Toll/interleukin-1 receptor homology (TIR) domain

NDVFISYRAADTRYNFTDHLYSNLQQKGIKTFMDTDYKRGEEMSPALWNEIEGSKISIIVFSENFGSSSWCLDELVKILDCKSSKQQMVMPIFYKVKPSHVRKQLGTFGEAFVDHERIFINDMEKVMRWRAVLTEAANL

HMMSmart: SM00255
IPR000157
1-139 Toll
Toll/interleukin-1 receptor homology (TIR) domain

NDVFISYRAADTRYNFTDHLYSNLQQKGIKTFMDTDYKRGEEMSPALWNEIEGSKISIIVFSENFGSSSWCLDELVKILDCKSSKQQMVMPIFYKVKPSHVRKQLGTFGEAFVDHERIFINDMEKVMRWRAVLTEAANL

Gene3D: G3DSA:3.40.50.10140
2-125 no description

DVFISYRAADTRYNFTDHLYSNLQQKGIKTFMDTDYKRGEEMSPALWNEIEGSKISIIVFSENFGSSSWCLDELVKILDCKSSKQQMVMPIFYKVKPSHVRKQLGTFGEAFVDHERIFINDMEK

superfamily: SSF52200
IPR000157
2-142 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

DVFISYRAADTRYNFTDHLYSNLQQKGIKTFMDTDYKRGEEMSPALWNEIEGSKISIIVFSENFGSSSWCLDELVKILDCKSSKQQMVMPIFYKVKPSHVRKQLGTFGEAFVDHERIFINDMEKVMRWRAVLTEAANLHGW

HMMPfam: PF01582
IPR000157
3-134 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFISYRAADTRYNFTDHLYSNLQQKGIKTFMDTDYKRGEEMSPALWNEIEGSKISIIVFSENFGSSSWCLDELVKILDCKSSKQQMVMPIFYKVKPSHVRKQLGTFGEAFVDHERIFINDMEKVMRWRAVLT

HMMPanther: PTHR11017
25-413 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QQKGIKTFMDTDYKRGEEMSPALWNEIEGSKISIIVFSENFGSSSWCLDELVKILDCKSSKQQMVMPIFYKVKPSHVRKQLGTFGEAFVDHERIFINDMEKVMRWRAVLTEAANLHGWTLKDGSESKFINDIVEEISLQVLNRTYLHVAKYPVGIESRLQDMGELLGAGVNDVRMVGIWGIRGIGKTTIAKAVYNSIVHQFEGSCFLENVRENSAAPRGLLQLQKTLLYEILGGKELELTSVDKGINVIKQRLSHKRVLLMLDDVDQLDQLNKLAGRSDWLGLGSRIIITTRHKHLLTSHQVDLVYEVKELDTYEASELFSYNAFPEKGLPDDYKNLAVSLVDYAKGIPLALTVTGSLLCGRSVDEWRAALDCYRRAPSLDTDEILKIT

HMMPanther: PTHR11017:SF20
25-413 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QQKGIKTFMDTDYKRGEEMSPALWNEIEGSKISIIVFSENFGSSSWCLDELVKILDCKSSKQQMVMPIFYKVKPSHVRKQLGTFGEAFVDHERIFINDMEKVMRWRAVLTEAANLHGWTLKDGSESKFINDIVEEISLQVLNRTYLHVAKYPVGIESRLQDMGELLGAGVNDVRMVGIWGIRGIGKTTIAKAVYNSIVHQFEGSCFLENVRENSAAPRGLLQLQKTLLYEILGGKELELTSVDKGINVIKQRLSHKRVLLMLDDVDQLDQLNKLAGRSDWLGLGSRIIITTRHKHLLTSHQVDLVYEVKELDTYEASELFSYNAFPEKGLPDDYKNLAVSLVDYAKGIPLALTVTGSLLCGRSVDEWRAALDCYRRAPSLDTDEILKIT

superfamily: SSF52540
157-401 P-loop containing nucleoside triphosphate hydrolases

VEEISLQVLNRTYLHVAKYPVGIESRLQDMGELLGAGVNDVRMVGIWGIRGIGKTTIAKAVYNSIVHQFEGSCFLENVRENSAAPRGLLQLQKTLLYEILGGKELELTSVDKGINVIKQRLSHKRVLLMLDDVDQLDQLNKLAGRSDWLGLGSRIIITTRHKHLLTSHQVDLVYEVKELDTYEASELFSYNAFPEKGLPDDYKNLAVSLVDYAKGIPLALTVTGSLLCGRSVDEWRAALDCYRRA

Gene3D: G3DSA:3.40.50.300
178-324 no description

GIESRLQDMGELLGAGVNDVRMVGIWGIRGIGKTTIAKAVYNSIVHQFEGSCFLENVRENSAAPRGLLQLQKTLLYEILGGKELELTSVDKGINVIKQRLSHKRVLLMLDDVDQLDQLNKLAGRSDWLGLGSRIIITTRHKHLLTSH

HMMPfam: PF00931
IPR002182
189-414 NB-ARC,NBS
NB-ARC

LLGAGVNDVRMVGIWGIRGIGKTTIAKAVYNSIVHQFEGSCFLENVRENSAAPRGLLQLQKTLLYEILGGKELELTSVDKGINVIKQRLSHKRVLLMLDDVDQLDQLNKLAGRSDWLGLGSRIIITTRHKHLLTSHQVDLVYEVKELDTYEASELFSYNAFPEKGLPDDYKNLAVSLVDYAKGIPLALTVTGSLLCGRSVDEWRAALDCYRRAPSLDTDEILKITK

FPrintScan: PR00364
IPR000767
199-214 DISEASERSIST
Disease resistance protein

MVGIWGIRGIGKTTIA

FPrintScan: PR00364
IPR000767
276-290 DISEASERSIST
Disease resistance protein

RLSHKRVLLMLDDVD

Seg: seg
282-295 seg

VLLMLDDVDQLDQL

FPrintScan: PR00364
IPR000767
369-383 DISEASERSIST
Disease resistance protein

AKGIPLALTVTGSLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox