PRGDB00172510 (ppa003654m)

From PRG Wiki
Jump to: navigation, search
ppa003654m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Prunus persica

Comment?

NSP-interacting kinase 3 (best arabidopsis hit)

DNA Sequence

ATGGTTACTTGTACCGCCGATGGCTATGTATCTGCTCTGGGATTGCCTAGCCAGAGCTTGTCTGGTATCTTATCTCCTGCAATTGGCAACCTCAGTAACTTGCAATCTGTATTGCTTCAAAATAATGCCATCTCAGGTCCAATTCCTGCTACAATTGGGATTTTGGAGAAGCTTCAGACACTTGATCTCTCCAATAATTCTTTCACTGGTGAGATACCAGATTCTTTAGGCAACCTGAAGAACCTGAATTATTTGCGGTTAAACAACAACAGCCTTACAGGACCCTGCCCTGAGTCTCTGTCCACGGTTGAAGGTCTCACTCTTGTGGACCTTTCTTTCAACAATCTGAGCGGAACCTTGCCAAAAATATCCGCAAGAACTTTCAAAATTGTAGGAAACCCTTTGATTTGTGGTGTAAAGGCTGAGAACTGTTCTGCTGTCCTTCCAGAGCCCCTATCTCTCCCGCCTGATGCTCTAAAAGCTCAATCAGACTCTAGGATGAAACGCCGCCACATGACTATAGTCTTTGGGACAAGCTTTGGAGCTGCTCTTGGTGTCATAATAATTATTGGGTTACTTGTTTGGTGGCGATACAGACACAACCAGCAGATATTCTTTGATGTCAATGACCAATATGACCCAGAAGTGTGCTTGGGGCATTTGAAGAGGTATACATTTAAGGAGCTCCGGGCAGCAACGGATCATTTCAACTCAAAGAACATTCTAGGGAGGGGTGGTTTTGGGATTGTATACAAGGGAAGCTTGAACGATGGGACTCTGGTGGCAGTTAAAAGGCTAAAGGACTACAATACTGCTGGTGGCGAAATCCAGTTTCAGACAGAAGTAGAGATGATTAGTTTGGCTGTACATCGAAATCTTCTGAGGCTTTGCGGGTTTTGTTCAACTGAGAATGAAAGACTTCTTGTTTACCCTTTTATGCCTAATGGAAGTGTAGCCTCTCGATTAAGAGATCATATACACGGTCGACCAGCTCTAGACTGGGCAAGGAGAAAGAGAATAGCCTTAGGGACGGCCAGGGGGTTGGTTTATTTGCATGAGCAGTGTGACCCCAGAATTATCCATCGTGATGTTAAAGCAGCCAATATTTTGCTAGATGAAGACTTCGAGGCAGTTGTTGGAGATTTTGGGTTGGCAAAGCTTTTGGATCACAGAGAATCCCATGTGACCACAGCTGTGCGCGGCACTGTTGGCCACATTGCTCCAGAGTATTTGTCAACAGGTCAGTCATCAGACAAGACAGATGTGTTTGGGTTTGGGATCTTGCTCCTGGAGCTAATCACAGGTCAAAAGGCTTTGGACTTTGGACGAGTTGCAAACCAGAAGGGTGTAATGCTTGATTGGGTGAAGAAGCTCCATCAGGAGGGAAAGGTGAATCTCATGGTGGATAAGGATCTAAAGGGCAATTTCGACAGGGTTGAGTTGGAAGAAATGGTTCAGGTTGCCCTGTTATGTACTCAATTTAATCCTTTGCACCGACCAAAAATGTCTGAAGTATTAAAGATGTTGGAGGGTGATGGTTTAGCCGAGAAATGGGAGGCCTCACAGAAGGTTGAGACACCAAGGTTCCGGTCATGTGAACACCCGCGGCAAAGATATTCAGATTTTATAGAAGAATCTTCACTTGTGTTAGAAGCTATGGAGCTTTCTGGCCCTAGGTGA


Protein sequences

Name Description Sequence
ppa003654m NSP-interacting kinase 3 (best arabidopsis hit)

MVTCTADGYVSALGLPSQSLSGILSPAIGNLSNLQSVLLQNNAISGPIPATIGILEKLQTLDLSNNSFTGEIPDSLGNLKNLNYLRLNNNSLTGPCPESLSTVEGLTLVDLSFNNLSGTLPKISARTFKIVGNPLICGVKAENCSAVLPEPLSLPPDALKAQSDSRMKRRHMTIVFGTSFGAALGVIIIIGLLVWWRYRHNQQIFFDVNDQYDPEVCLGHLKRYTFKELRAATDHFNSKNILGRGGFGIVYKGSLNDGTLVAVKRLKDYNTAGGEIQFQTEVEMISLAVHRNLLRLCGFCSTENERLLVYPFMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRSCEHPRQRYSDFIEESSLVLEAMELSGPR*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-555 FAMILY NOT NAMED,FAMILY NOT NAMED

MVTCTADGYVSALGLPSQSLSGILSPAIGNLSNLQSVLLQNNAISGPIPATIGILEKLQTLDLSNNSFTGEIPDSLGNLKNLNYLRLNNNSLTGPCPESLSTVEGLTLVDLSFNNLSGTLPKISARTFKIVGNPLICGVKAENCSAVLPEPLSLPPDALKAQSDSRMKRRHMTIVFGTSFGAALGVIIIIGLLVWWRYRHNQQIFFDVNDQYDPEVCLGHLKRYTFKELRAATDHFNSKNILGRGGFGIVYKGSLNDGTLVAVKRLKDYNTAGGEIQFQTEVEMISLAVHRNLLRLCGFCSTENERLLVYPFMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRSCEHPRQRYSDFIEESSLVLEAMEL

HMMPanther: PTHR24420:SF851
1-555 SUBFAMILY NOT NAMED

MVTCTADGYVSALGLPSQSLSGILSPAIGNLSNLQSVLLQNNAISGPIPATIGILEKLQTLDLSNNSFTGEIPDSLGNLKNLNYLRLNNNSLTGPCPESLSTVEGLTLVDLSFNNLSGTLPKISARTFKIVGNPLICGVKAENCSAVLPEPLSLPPDALKAQSDSRMKRRHMTIVFGTSFGAALGVIIIIGLLVWWRYRHNQQIFFDVNDQYDPEVCLGHLKRYTFKELRAATDHFNSKNILGRGGFGIVYKGSLNDGTLVAVKRLKDYNTAGGEIQFQTEVEMISLAVHRNLLRLCGFCSTENERLLVYPFMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRSCEHPRQRYSDFIEESSLVLEAMEL

Gene3D: G3DSA:3.80.10.10
2-122 no description

VTCTADGYVSALGLPSQSLSGILSPAIGNLSNLQSVLLQNNAISGPIPATIGILEKLQTLDLSNNSFTGEIPDSLGNLKNLNYLRLNNNSLTGPCPESLSTVEGLTLVDLSFNNLSGTLPK

superfamily: SSF52058
13-145 L domain-like,LRR

LGLPSQSLSGILSPAIGNLSNLQSVLLQNNAISGPIPATIGILEKLQTLDLSNNSFTGEIPDSLGNLKNLNYLRLNNNSLTGPCPESLSTVEGLTLVDLSFNNLSGTLPKISARTFKIVGNPLICGVKAENCS

Seg: seg
30-42 seg

NLSNLQSVLLQNN

ProfileScan: PS51450
IPR001611
57-80 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQTLDLSNNSFTGEIPDSLGNLK

HMMPfam: PF13855
57-116 LRR_8,Leucine rich repeat

KLQTLDLSNNSFTGEIPDSLGNLKNLNYLRLNNNSLTGPCPESLSTVEGLTLVDLSFNNL

Seg: seg
76-92 seg

LGNLKNLNYLRLNNNSL

ProfileScan: PS51450
IPR001611
81-102 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLNYLRLNNNSLTGPCPESLST

ProfileScan: PS51450
IPR001611
105-127 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLTLVDLSFNNLSGTLPKISART

Seg: seg
181-194 seg

GAALGVIIIIGLLV

Gene3D: G3DSA:3.30.200.20
220-313 no description

HLKRYTFKELRAATDHFNSKNILGRGGFGIVYKGSLNDGTLVAVKRLKDYNTAGGEIQFQTEVEMISLAVHRNLLRLCGFCSTENERLLVYPFM

superfamily: SSF56112
IPR011009
222-540 Protein kinase-like (PK-like)
Protein kinase-like domain

KRYTFKELRAATDHFNSKNILGRGGFGIVYKGSLNDGTLVAVKRLKDYNTAGGEIQFQTEVEMISLAVHRNLLRLCGFCSTENERLLVYPFMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWEASQKVETPRFRSCEHPRQRYS

ProfileScan: PS50011
IPR000719
236-519 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNSKNILGRGGFGIVYKGSLNDGTLVAVKRLKDYNTAGGEIQFQTEVEMISLAVHRNLLRLCGFCSTENERLLVYPFMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKMLEGDGLAEKWE

HMMSmart: SM00219
IPR020635
236-509 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNSKNILGRGGFGIVYKGSLNDGTLVAVKRLKDYNTAGGEIQFQTEVEMISLAVHRNLLRLCGFCSTENERLLVYPFMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKML

HMMSmart: SM00220
IPR002290
236-509 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNSKNILGRGGFGIVYKGSLNDGTLVAVKRLKDYNTAGGEIQFQTEVEMISLAVHRNLLRLCGFCSTENERLLVYPFMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKML

HMMPfam: PF00069
IPR000719
238-507 Pkinase,Ser-thr
Protein kinase, catalytic domain

SKNILGRGGFGIVYKGSLNDGTLVAVKRLKDYNTAGGEIQFQTEVEMISLAVHRNLLRLCGFCSTENERLLVYPFMPNGSVASRLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLK

PatternScan: PS00107
IPR017441
242-264 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGIVYKGSLNDGTLVAVK

Gene3D: G3DSA:1.10.510.10
321-509 no description

RLRDHIHGRPALDWARRKRIALGTARGLVYLHEQCDPRIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVTTAVRGTVGHIAPEYLSTGQSSDKTDVFGFGILLLELITGQKALDFGRVANQKGVMLDWVKKLHQEGKVNLMVDKDLKGNFDRVELEEMVQVALLCTQFNPLHRPKMSEVLKML

PatternScan: PS00108
IPR008271
359-371 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox